Bison bison bison (American bison): 104985237 Help Entry 104985237         CDS       T08726                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism bbis  Bison bison bison (American bison) Pathway bbis04024   cAMP signaling pathway bbis04062   Chemokine signaling pathway bbis04064   NF-kappa B signaling pathway bbis04210   Apoptosis bbis04380   Osteoclast differentiation bbis04519   Cadherin signaling bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04625   C-type lectin receptor signaling pathway bbis04657   IL-17 signaling pathway bbis04658   Th1 and Th2 cell differentiation bbis04659   Th17 cell differentiation bbis04660   T cell receptor signaling pathway bbis04662   B cell receptor signaling pathway bbis04668   TNF signaling pathway bbis04722   Neurotrophin signaling pathway bbis04920   Adipocytokine signaling pathway bbis04926   Relaxin signaling pathway bbis04931   Insulin resistance bbis04936   Alcoholic liver disease bbis05132   Salmonella infection bbis05134   Legionellosis bbis05135   Yersinia infection bbis05140   Leishmaniasis bbis05142   Chagas disease bbis05145   Toxoplasmosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease bbis05200   Pathways in cancer bbis05203   Viral carcinogenesis bbis05208   Chemical carcinogenesis - reactive oxygen species bbis05215   Prostate cancer bbis05220   Chronic myeloid leukemia bbis05222   Small cell lung cancer bbis05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     104985237 (NFKBIA)    04668 TNF signaling pathway     104985237 (NFKBIA)    04024 cAMP signaling pathway     104985237 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     104985237 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     104985237 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104985237 (NFKBIA)    04621 NOD-like receptor signaling pathway     104985237 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     104985237 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     104985237 (NFKBIA)    04625 C-type lectin receptor signaling pathway     104985237 (NFKBIA)    04660 T cell receptor signaling pathway     104985237 (NFKBIA)    04658 Th1 and Th2 cell differentiation     104985237 (NFKBIA)    04659 Th17 cell differentiation     104985237 (NFKBIA)    04657 IL-17 signaling pathway     104985237 (NFKBIA)    04662 B cell receptor signaling pathway     104985237 (NFKBIA)    04062 Chemokine signaling pathway     104985237 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     104985237 (NFKBIA)    04926 Relaxin signaling pathway     104985237 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     104985237 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     104985237 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104985237 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     104985237 (NFKBIA)    05203 Viral carcinogenesis     104985237 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     104985237 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     104985237 (NFKBIA)    05215 Prostate cancer     104985237 (NFKBIA)    05222 Small cell lung cancer     104985237 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     104985237 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     104985237 (NFKBIA)    05161 Hepatitis B     104985237 (NFKBIA)    05160 Hepatitis C     104985237 (NFKBIA)    05171 Coronavirus disease     104985237 (NFKBIA)    05164 Influenza A     104985237 (NFKBIA)    05162 Measles     104985237 (NFKBIA)    05168 Herpes simplex virus 1 infection     104985237 (NFKBIA)    05163 Human cytomegalovirus infection     104985237 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     104985237 (NFKBIA)    05169 Epstein-Barr virus infection     104985237 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     104985237 (NFKBIA)    05135 Yersinia infection     104985237 (NFKBIA)    05134 Legionellosis     104985237 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     104985237 (NFKBIA)    05140 Leishmaniasis     104985237 (NFKBIA)    05142 Chagas disease     104985237 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104985237 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     104985237 (NFKBIA)    04931 Insulin resistance     104985237 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbis03000]     104985237 (NFKBIA)    04131 Membrane trafficking [BR:bbis04131]     104985237 (NFKBIA) Transcription factors [BR:bbis03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     104985237 (NFKBIA) Membrane trafficking [BR:bbis04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     104985237 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  104985237 NCBI-ProteinID:  XP_010833602 Ensembl:  ENSBBBG00000009508 UniProt:  A0A6P3H3J7 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cggggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcactta gccatcatccatgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgggggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagtcacctaccagggttactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccggagagcgaggatgaggagagctacgacaccgaatcagagttcacagaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system