Bison bison bison (American bison): 104985333 Help Entry 104985333         CDS       T08726                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism bbis  Bison bison bison (American bison) Pathway bbis04080   Neuroactive ligand-receptor interaction bbis04081   Hormone signaling bbis04911   Insulin secretion bbis04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     104985333 (CCK)    04081 Hormone signaling     104985333 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     104985333 (CCK)   09154 Digestive system    04972 Pancreatic secretion     104985333 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104985333 (CCK) Cytokines and neuropeptides [BR:bbis04052]  Neuropeptides   GPCR binding    104985333 (CCK) SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A Motif Other DBs NCBI-GeneID:  104985333 NCBI-ProteinID:  XP_010833754 Ensembl:  ENSBBBG00000022612 UniProt:  A0A6P3H3Q9 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MNRGVCLCLLMAVLAAGALAQPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAHLGA LLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcggcgtgtgcctgtgcttgctgatggcggtcctggcggcgggcgccctggcg cagccgatgcctcacgcggaccccacgggccctcgggcgcagcaggcggaggaggcgccc cggaggcagctgagggcggtgccgagggtggacgacgagccccgagcacacctgggcgcg ctgctggccaggtacatccagcaggctcggaaagctccttctggccgaatgtctgtgatc aagaacctgcaaagcctggaccccagccacaggataagtgaccgggactacatgggctgg atggattttggccgtcgcagcgctgaggagtttgaatacacctcctag

DBGET integrated database retrieval system