Bison bison bison (American bison): 104985956 Help Entry 104985956         CDS       T08726                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism bbis  Bison bison bison (American bison) Pathway bbis03008   Ribosome biogenesis in eukaryotes bbis03013   Nucleocytoplasmic transport bbis03015   mRNA surveillance pathway bbis05014   Amyotrophic lateral sclerosis bbis05164   Influenza A Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     104985956 (NXT1)    03015 mRNA surveillance pathway     104985956 (NXT1)    03008 Ribosome biogenesis in eukaryotes     104985956 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104985956 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     104985956 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bbis03019]     104985956 (NXT1)    03009 Ribosome biogenesis [BR:bbis03009]     104985956 (NXT1) Messenger RNA biogenesis [BR:bbis03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      104985956 (NXT1) Ribosome biogenesis [BR:bbis03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     104985956 (NXT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  104985956 NCBI-ProteinID:  XP_010834646 UniProt:  A0A6P3GY95 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MGTATLVWNGNAVSGQESLSEFFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTV KFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAC NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgggcacagccaccctggtgtggaacggcaacgccgtctccgggcaagagtccctgagt gagttttttgagatgctgccttccagcgagttccagatcaacgtggtagactgccagcct gtccatgacgaagccaccccgagccagaccacagtccttgtggtgatctgtgggacagtg aagtttgagggcaacaaacagcgggacttcaaccagaacttcatcctgacggcccaggcc tcacccagcaacacagtgtggaagatcgccagcgactgcttccggttccaggactgggcc tgctag

DBGET integrated database retrieval system