Bison bison bison (American bison): 104985989 Help Entry 104985989         CDS       T08726                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104985989  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104985989   09163 Immune disease    05322 Systemic lupus erythematosus     104985989   09165 Substance dependence    05034 Alcoholism     104985989  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104985989 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104985989 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF Bromo_TP TFIID-31kDa UPF0137 Motif Other DBs NCBI-GeneID:  104985989 NCBI-ProteinID:  XP_010834692 Ensembl:  ENSBBBG00000021582 UniProt:  A0A6P3H695 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYTLKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaagggcgggaagggccttggaaaaggtggcgcaaagcgtcaccgc aaggttcttcgcgataacatccagggtatcaccaagcccgccatccgtcgtctggctcgg cgtggaggagttaagcgtatttctggcctcatctatgaggagacccgcggggtgttgaag gtgttcctggaaaatgtgatccgtgatgcggtcacctacaccgagcatgccaagcgcaaa actgtcacagccatggatgtggtctacacgctgaaacgccagggccgcaccctctacggc tttgggggttaa

DBGET integrated database retrieval system