KEGG   Bison bison bison (American bison): 104986748
Entry
104986748         CDS       T08726                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bbis  Bison bison bison (American bison)
Pathway
bbis01521  EGFR tyrosine kinase inhibitor resistance
bbis01522  Endocrine resistance
bbis01524  Platinum drug resistance
bbis04010  MAPK signaling pathway
bbis04012  ErbB signaling pathway
bbis04014  Ras signaling pathway
bbis04015  Rap1 signaling pathway
bbis04022  cGMP-PKG signaling pathway
bbis04024  cAMP signaling pathway
bbis04062  Chemokine signaling pathway
bbis04066  HIF-1 signaling pathway
bbis04068  FoxO signaling pathway
bbis04071  Sphingolipid signaling pathway
bbis04072  Phospholipase D signaling pathway
bbis04114  Oocyte meiosis
bbis04140  Autophagy - animal
bbis04148  Efferocytosis
bbis04150  mTOR signaling pathway
bbis04151  PI3K-Akt signaling pathway
bbis04210  Apoptosis
bbis04218  Cellular senescence
bbis04261  Adrenergic signaling in cardiomyocytes
bbis04270  Vascular smooth muscle contraction
bbis04350  TGF-beta signaling pathway
bbis04360  Axon guidance
bbis04370  VEGF signaling pathway
bbis04371  Apelin signaling pathway
bbis04380  Osteoclast differentiation
bbis04510  Focal adhesion
bbis04517  IgSF CAM signaling
bbis04520  Adherens junction
bbis04540  Gap junction
bbis04550  Signaling pathways regulating pluripotency of stem cells
bbis04611  Platelet activation
bbis04613  Neutrophil extracellular trap formation
bbis04620  Toll-like receptor signaling pathway
bbis04621  NOD-like receptor signaling pathway
bbis04625  C-type lectin receptor signaling pathway
bbis04650  Natural killer cell mediated cytotoxicity
bbis04657  IL-17 signaling pathway
bbis04658  Th1 and Th2 cell differentiation
bbis04659  Th17 cell differentiation
bbis04660  T cell receptor signaling pathway
bbis04662  B cell receptor signaling pathway
bbis04664  Fc epsilon RI signaling pathway
bbis04666  Fc gamma R-mediated phagocytosis
bbis04668  TNF signaling pathway
bbis04713  Circadian entrainment
bbis04720  Long-term potentiation
bbis04722  Neurotrophin signaling pathway
bbis04723  Retrograde endocannabinoid signaling
bbis04724  Glutamatergic synapse
bbis04725  Cholinergic synapse
bbis04726  Serotonergic synapse
bbis04730  Long-term depression
bbis04810  Regulation of actin cytoskeleton
bbis04910  Insulin signaling pathway
bbis04912  GnRH signaling pathway
bbis04914  Progesterone-mediated oocyte maturation
bbis04915  Estrogen signaling pathway
bbis04916  Melanogenesis
bbis04917  Prolactin signaling pathway
bbis04919  Thyroid hormone signaling pathway
bbis04921  Oxytocin signaling pathway
bbis04926  Relaxin signaling pathway
bbis04928  Parathyroid hormone synthesis, secretion and action
bbis04929  GnRH secretion
bbis04930  Type II diabetes mellitus
bbis04933  AGE-RAGE signaling pathway in diabetic complications
bbis04934  Cushing syndrome
bbis04935  Growth hormone synthesis, secretion and action
bbis04960  Aldosterone-regulated sodium reabsorption
bbis05010  Alzheimer disease
bbis05020  Prion disease
bbis05022  Pathways of neurodegeneration - multiple diseases
bbis05034  Alcoholism
bbis05132  Salmonella infection
bbis05133  Pertussis
bbis05135  Yersinia infection
bbis05140  Leishmaniasis
bbis05142  Chagas disease
bbis05145  Toxoplasmosis
bbis05152  Tuberculosis
bbis05160  Hepatitis C
bbis05161  Hepatitis B
bbis05163  Human cytomegalovirus infection
bbis05164  Influenza A
bbis05165  Human papillomavirus infection
bbis05166  Human T-cell leukemia virus 1 infection
bbis05167  Kaposi sarcoma-associated herpesvirus infection
bbis05170  Human immunodeficiency virus 1 infection
bbis05171  Coronavirus disease - COVID-19
bbis05200  Pathways in cancer
bbis05203  Viral carcinogenesis
bbis05205  Proteoglycans in cancer
bbis05206  MicroRNAs in cancer
bbis05207  Chemical carcinogenesis - receptor activation
bbis05208  Chemical carcinogenesis - reactive oxygen species
bbis05210  Colorectal cancer
bbis05211  Renal cell carcinoma
bbis05212  Pancreatic cancer
bbis05213  Endometrial cancer
bbis05214  Glioma
bbis05215  Prostate cancer
bbis05216  Thyroid cancer
bbis05218  Melanoma
bbis05219  Bladder cancer
bbis05220  Chronic myeloid leukemia
bbis05221  Acute myeloid leukemia
bbis05223  Non-small cell lung cancer
bbis05224  Breast cancer
bbis05225  Hepatocellular carcinoma
bbis05226  Gastric cancer
bbis05230  Central carbon metabolism in cancer
bbis05231  Choline metabolism in cancer
bbis05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbis05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbis00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104986748 (MAPK3)
   04012 ErbB signaling pathway
    104986748 (MAPK3)
   04014 Ras signaling pathway
    104986748 (MAPK3)
   04015 Rap1 signaling pathway
    104986748 (MAPK3)
   04350 TGF-beta signaling pathway
    104986748 (MAPK3)
   04370 VEGF signaling pathway
    104986748 (MAPK3)
   04371 Apelin signaling pathway
    104986748 (MAPK3)
   04668 TNF signaling pathway
    104986748 (MAPK3)
   04066 HIF-1 signaling pathway
    104986748 (MAPK3)
   04068 FoxO signaling pathway
    104986748 (MAPK3)
   04072 Phospholipase D signaling pathway
    104986748 (MAPK3)
   04071 Sphingolipid signaling pathway
    104986748 (MAPK3)
   04024 cAMP signaling pathway
    104986748 (MAPK3)
   04022 cGMP-PKG signaling pathway
    104986748 (MAPK3)
   04151 PI3K-Akt signaling pathway
    104986748 (MAPK3)
   04150 mTOR signaling pathway
    104986748 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    104986748 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104986748 (MAPK3)
   04148 Efferocytosis
    104986748 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104986748 (MAPK3)
   04210 Apoptosis
    104986748 (MAPK3)
   04218 Cellular senescence
    104986748 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104986748 (MAPK3)
   04520 Adherens junction
    104986748 (MAPK3)
   04540 Gap junction
    104986748 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    104986748 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104986748 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104986748 (MAPK3)
   04613 Neutrophil extracellular trap formation
    104986748 (MAPK3)
   04620 Toll-like receptor signaling pathway
    104986748 (MAPK3)
   04621 NOD-like receptor signaling pathway
    104986748 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    104986748 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    104986748 (MAPK3)
   04660 T cell receptor signaling pathway
    104986748 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    104986748 (MAPK3)
   04659 Th17 cell differentiation
    104986748 (MAPK3)
   04657 IL-17 signaling pathway
    104986748 (MAPK3)
   04662 B cell receptor signaling pathway
    104986748 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    104986748 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    104986748 (MAPK3)
   04062 Chemokine signaling pathway
    104986748 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104986748 (MAPK3)
   04929 GnRH secretion
    104986748 (MAPK3)
   04912 GnRH signaling pathway
    104986748 (MAPK3)
   04915 Estrogen signaling pathway
    104986748 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    104986748 (MAPK3)
   04917 Prolactin signaling pathway
    104986748 (MAPK3)
   04921 Oxytocin signaling pathway
    104986748 (MAPK3)
   04926 Relaxin signaling pathway
    104986748 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    104986748 (MAPK3)
   04919 Thyroid hormone signaling pathway
    104986748 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    104986748 (MAPK3)
   04916 Melanogenesis
    104986748 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104986748 (MAPK3)
   04270 Vascular smooth muscle contraction
    104986748 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104986748 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104986748 (MAPK3)
   04725 Cholinergic synapse
    104986748 (MAPK3)
   04726 Serotonergic synapse
    104986748 (MAPK3)
   04720 Long-term potentiation
    104986748 (MAPK3)
   04730 Long-term depression
    104986748 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    104986748 (MAPK3)
   04722 Neurotrophin signaling pathway
    104986748 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    104986748 (MAPK3)
   04380 Osteoclast differentiation
    104986748 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104986748 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104986748 (MAPK3)
   05206 MicroRNAs in cancer
    104986748 (MAPK3)
   05205 Proteoglycans in cancer
    104986748 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    104986748 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    104986748 (MAPK3)
   05203 Viral carcinogenesis
    104986748 (MAPK3)
   05230 Central carbon metabolism in cancer
    104986748 (MAPK3)
   05231 Choline metabolism in cancer
    104986748 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104986748 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104986748 (MAPK3)
   05212 Pancreatic cancer
    104986748 (MAPK3)
   05225 Hepatocellular carcinoma
    104986748 (MAPK3)
   05226 Gastric cancer
    104986748 (MAPK3)
   05214 Glioma
    104986748 (MAPK3)
   05216 Thyroid cancer
    104986748 (MAPK3)
   05221 Acute myeloid leukemia
    104986748 (MAPK3)
   05220 Chronic myeloid leukemia
    104986748 (MAPK3)
   05218 Melanoma
    104986748 (MAPK3)
   05211 Renal cell carcinoma
    104986748 (MAPK3)
   05219 Bladder cancer
    104986748 (MAPK3)
   05215 Prostate cancer
    104986748 (MAPK3)
   05213 Endometrial cancer
    104986748 (MAPK3)
   05224 Breast cancer
    104986748 (MAPK3)
   05223 Non-small cell lung cancer
    104986748 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104986748 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    104986748 (MAPK3)
   05161 Hepatitis B
    104986748 (MAPK3)
   05160 Hepatitis C
    104986748 (MAPK3)
   05171 Coronavirus disease - COVID-19
    104986748 (MAPK3)
   05164 Influenza A
    104986748 (MAPK3)
   05163 Human cytomegalovirus infection
    104986748 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104986748 (MAPK3)
   05165 Human papillomavirus infection
    104986748 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104986748 (MAPK3)
   05135 Yersinia infection
    104986748 (MAPK3)
   05133 Pertussis
    104986748 (MAPK3)
   05152 Tuberculosis
    104986748 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104986748 (MAPK3)
   05140 Leishmaniasis
    104986748 (MAPK3)
   05142 Chagas disease
    104986748 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104986748 (MAPK3)
   05020 Prion disease
    104986748 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    104986748 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    104986748 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    104986748 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104986748 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104986748 (MAPK3)
   04934 Cushing syndrome
    104986748 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104986748 (MAPK3)
   01524 Platinum drug resistance
    104986748 (MAPK3)
   01522 Endocrine resistance
    104986748 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbis01001]
    104986748 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbis03036]
    104986748 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbis04147]
    104986748 (MAPK3)
Enzymes [BR:bbis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104986748 (MAPK3)
Protein kinases [BR:bbis01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104986748 (MAPK3)
Chromosome and associated proteins [BR:bbis03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     104986748 (MAPK3)
Exosome [BR:bbis04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104986748 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 104986748
NCBI-ProteinID: XP_010835733
UniProt: A0A6P3GWM5
LinkDB
Position
Unknown
AA seq 495 aa
MCEEATSHGYYEISIVSLSIGPGSRRFHLEPRATPRAEWGQRGHVARSGSRLQHSFARWL
WVRSPGRPTGQHSVRGWGEGLDSLETALGSFYVDWSRRGRQVPGTTAPATGKRHRRAAWL
VPSFLPGDPRPSQQEGTSIVYDWPEPSPAPSPPCQGLGGATRPGHQHLSGPLSSAYDHVR
KTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDL
METDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDPKAL
DLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELI
FQETARFQPGVLEAS
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgtgtgaggaagccacctcccacggctactatgaaataagcatcgtatcactcagcatt
gggcctggctccaggaggttccacctcgagccccgggccactcctcgggctgagtggggg
cagcggggccacgtggcccggtctgggtcccggctccagcactcatttgctaggtggctc
tgggtgaggtcaccgggccgccctacaggtcagcattcggtgagggggtggggggagggt
ctggacagtctcgagactgccctggggagcttctacgttgactggagcagacgaggccga
caggtgccagggaccacagccccagcgacgggaaagcgtcaccgaagggctgcctggctg
gtccccagctttctccctggagatcccaggccttcacagcaggaaggaaccagcattgtt
tatgactggccagagccctctcctgctccctccccgccctgccaaggcctgggtggggcc
accaggcctggacaccaacatctctctggccctctcagctcagcttacgaccacgtgcgc
aagactcgagtggccatcaagaaaatcagcccctttgagcatcagacctactgccagcgc
acattgcgagagattcagattctgctgcgcttccgccatgagaacgtcattggcatccga
gacattctgcgggcacccaccctggaagccatgagggatgtctacatcgtacaggacctg
atggagacagacctgtacaaattgctcaaaagccagcagctgagcaacgaccatgtatgc
tacttcctgtaccagatcctgcggggcctgaagtatatccactccgccaacgtgctccac
cgggatttaaagccctccaacctgctcatcaataccacctgcgaccttaagatctgtgat
ttcggtcttgcccggattgctgatcccgagcatgaccacactggctttctgacggaatat
gtggccacacgctggtaccgggccccagagatcatgcttaactccaagggctacaccaag
tccatcgacatctggtctgtgggctgcattctggctgagatgctctccaaccggcccatc
ttccccggcaagcactacctggaccagctcaaccacattctgggtattctgggctcccca
tcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactacctacagtctctg
ccctccaagaccaaggtggcctgggccaagctttttcctaagtcagaccccaaagctctt
gacctgctggaccggatgttgacctttaaccccaacaaacggatcacagtggaagaagcg
ctggctcacccctacctggagcagtactatgacccaacggatgagccagtggccgaggaa
cctttcaccttcgacatggagctggatgatctacccaaggaacgactgaaggagctcatc
ttccaggagacagcccgcttccagcctggggtgctggaagcctcctaa

DBGET integrated database retrieval system