Bison bison bison (American bison): 104986971 Help Entry 104986971         CDS       T08726                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism bbis  Bison bison bison (American bison) Pathway bbis03030   DNA replication bbis03410   Base excision repair bbis03420   Nucleotide excision repair bbis03430   Mismatch repair bbis03440   Homologous recombination Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104986971 (POLD4)    03410 Base excision repair     104986971 (POLD4)    03420 Nucleotide excision repair     104986971 (POLD4)    03430 Mismatch repair     104986971 (POLD4)    03440 Homologous recombination     104986971 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bbis03032]     104986971 (POLD4)    03400 DNA repair and recombination proteins [BR:bbis03400]     104986971 (POLD4) DNA replication proteins [BR:bbis03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     104986971 (POLD4) DNA repair and recombination proteins [BR:bbis03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       104986971 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      104986971 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 RepB Motif Other DBs NCBI-GeneID:  104986971 NCBI-ProteinID:  XP_010836013 Ensembl:  ENSBBBG00000011249 UniProt:  A0A6P3GXE3 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGSAGHSKGELAPDLGEEPLPLSVDEEELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLKPPPEVRQVLQSHPGDPRFQCSLWHFYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagggctcc gctgggcacagcaagggggagctggcaccagatctaggggaagagcccctacccctgagc gtggatgaagaggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc tgcacagggatcacacggttgcagcgctggcatcgggcagagcagatgggcttgaagcct cccccagaagtgcgtcaggtgctgcagagccaccccggggatccccgcttccagtgcagc ctctggcatttctacccgctctga

DBGET integrated database retrieval system