Bison bison bison (American bison): 104987056 Help Entry 104987056         CDS       T08726                                  Symbol CCND1 Name (RefSeq) G1/S-specific cyclin-D1   KO K04503   G1/S-specific cyclin-D1 Organism bbis  Bison bison bison (American bison) Pathway bbis01522   Endocrine resistance bbis04068   FoxO signaling pathway bbis04110   Cell cycle bbis04115   p53 signaling pathway bbis04151   PI3K-Akt signaling pathway bbis04152   AMPK signaling pathway bbis04218   Cellular senescence bbis04310   Wnt signaling pathway bbis04340   Hedgehog signaling pathway bbis04371   Apelin signaling pathway bbis04390   Hippo signaling pathway bbis04510   Focal adhesion bbis04530   Tight junction bbis04630   JAK-STAT signaling pathway bbis04917   Prolactin signaling pathway bbis04919   Thyroid hormone signaling pathway bbis04921   Oxytocin signaling pathway bbis04933   AGE-RAGE signaling pathway in diabetic complications bbis04934   Cushing syndrome bbis04936   Alcoholic liver disease bbis05160   Hepatitis C bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05165   Human papillomavirus infection bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05169   Epstein-Barr virus infection bbis05200   Pathways in cancer bbis05203   Viral carcinogenesis bbis05205   Proteoglycans in cancer bbis05206   MicroRNAs in cancer bbis05207   Chemical carcinogenesis - receptor activation bbis05210   Colorectal cancer bbis05212   Pancreatic cancer bbis05213   Endometrial cancer bbis05214   Glioma bbis05215   Prostate cancer bbis05216   Thyroid cancer bbis05218   Melanoma bbis05219   Bladder cancer bbis05220   Chronic myeloid leukemia bbis05221   Acute myeloid leukemia bbis05222   Small cell lung cancer bbis05223   Non-small cell lung cancer bbis05224   Breast cancer bbis05225   Hepatocellular carcinoma bbis05226   Gastric cancer bbis05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104987056 (CCND1)    04340 Hedgehog signaling pathway     104987056 (CCND1)    04390 Hippo signaling pathway     104987056 (CCND1)    04371 Apelin signaling pathway     104987056 (CCND1)    04630 JAK-STAT signaling pathway     104987056 (CCND1)    04068 FoxO signaling pathway     104987056 (CCND1)    04151 PI3K-Akt signaling pathway     104987056 (CCND1)    04152 AMPK signaling pathway     104987056 (CCND1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     104987056 (CCND1)    04115 p53 signaling pathway     104987056 (CCND1)    04218 Cellular senescence     104987056 (CCND1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104987056 (CCND1)    04530 Tight junction     104987056 (CCND1)  09150 Organismal Systems   09152 Endocrine system    04917 Prolactin signaling pathway     104987056 (CCND1)    04921 Oxytocin signaling pathway     104987056 (CCND1)    04919 Thyroid hormone signaling pathway     104987056 (CCND1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104987056 (CCND1)    05206 MicroRNAs in cancer     104987056 (CCND1)    05205 Proteoglycans in cancer     104987056 (CCND1)    05207 Chemical carcinogenesis - receptor activation     104987056 (CCND1)    05203 Viral carcinogenesis     104987056 (CCND1)   09162 Cancer: specific types    05210 Colorectal cancer     104987056 (CCND1)    05212 Pancreatic cancer     104987056 (CCND1)    05225 Hepatocellular carcinoma     104987056 (CCND1)    05226 Gastric cancer     104987056 (CCND1)    05214 Glioma     104987056 (CCND1)    05216 Thyroid cancer     104987056 (CCND1)    05221 Acute myeloid leukemia     104987056 (CCND1)    05220 Chronic myeloid leukemia     104987056 (CCND1)    05218 Melanoma     104987056 (CCND1)    05219 Bladder cancer     104987056 (CCND1)    05215 Prostate cancer     104987056 (CCND1)    05213 Endometrial cancer     104987056 (CCND1)    05224 Breast cancer     104987056 (CCND1)    05222 Small cell lung cancer     104987056 (CCND1)    05223 Non-small cell lung cancer     104987056 (CCND1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     104987056 (CCND1)    05160 Hepatitis C     104987056 (CCND1)    05162 Measles     104987056 (CCND1)    05163 Human cytomegalovirus infection     104987056 (CCND1)    05167 Kaposi sarcoma-associated herpesvirus infection     104987056 (CCND1)    05169 Epstein-Barr virus infection     104987056 (CCND1)    05165 Human papillomavirus infection     104987056 (CCND1)   09166 Cardiovascular disease    05416 Viral myocarditis     104987056 (CCND1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     104987056 (CCND1)    04933 AGE-RAGE signaling pathway in diabetic complications     104987056 (CCND1)    04934 Cushing syndrome     104987056 (CCND1)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     104987056 (CCND1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cyclin_C Cyclin_N DUF3556 Motif Other DBs NCBI-GeneID:  104987056 NCBI-ProteinID:  XP_010836120 UniProt:  A0A6P3HC27 LinkDB All DBs Position Unknown AA seq 285 aa AA seqDB search MAHQRLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV ATWMLEVRGSGRLAGPLASSTVPARNVGSRAVPLTSRTLQRPPSPLPVPCSTGVLACASR HAFPPGPQHMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRKHAQTFVALCA TDVKFISNPPSMVAAGSVAAAAQGLHLGSANGFLSYHRLTRFLSKVIRCDPDCLRACQEQ IEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI NT seq 858 nt NT seq  +upstreamnt  +downstreamnt atggcacaccagcgcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc aacctcctcaacgaccgagtgctgcgggccatgctcaaggcggaggagacctgcgcgccc tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg gccacctggatgctggaggtgcggggctccgggcggctggcaggacccttggcgagcagc accgtccctgctcggaatgtggggtcgcgcgctgtccccctcacttcccggaccctccag cgacccccatcccctctccccgtcccctgctccactggggtcctcgcctgcgcctctcga cacgcgtttcccccgggtccgcagcacatggagctggtcctggtgaacaaactcaagtgg aacctggcggccatgaccccgcacgacttcatcgagcacttcctctccaagatgccggtg gccgaggagaacaagcagatcatccgcaaacacgcgcagaccttcgttgccctctgtgcc acagacgtgaagttcatttccaacccgccctccatggtggccgccgggagcgtggcggcc gcggctcaaggcctgcatctgggaagcgccaacggcttcctctcctatcaccgcctgacg cggttcctctccaaggtgatcagatgtgacccggactgcctccgcgcctgccaggagcag atcgaagccctcctggagtccagcctgcgccaggcccagcagcagaacttggaccccaaa gccgcggaggaggaagaggaggaggaggaggtcgacctggcctgcacgcccaccgacgtg cgtgacgtgaacatctga

DBGET integrated database retrieval system