Bison bison bison (American bison): 104987542 Help Entry 104987542         CDS       T08726                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104987542  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104987542   09163 Immune disease    05322 Systemic lupus erythematosus     104987542   09165 Substance dependence    05034 Alcoholism     104987542  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104987542 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104987542 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  104987542 NCBI-ProteinID:  XP_010836838 Ensembl:  ENSBBBG00000002329 UniProt:  A0A6P3GZQ8 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVAAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaaggcggcaaaggtctggggaaaggcggcgctaagcgccaccgt aaggttctgcgcgacaacatccagggcatcactaaacctgctatccgccgcctggctcgt cgtggtggtgtgaagcgcatctctgggctcatctacgaagagacccgcggggtcctgaaa gtgtttctggagaacgtgatccgggacgcggtcacctacaccgagcatgccaagcggaag acagtcgccgctatggacgtggtctacgcactcaagcgccagggccgtactctctacggc tttggcggttaa

DBGET integrated database retrieval system