Bison bison bison (American bison): 104987694 Help Entry 104987694         CDS       T08726                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05202   Transcriptional misregulation in cancer bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104987694  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     104987694   09163 Immune disease    05322 Systemic lupus erythematosus     104987694   09165 Substance dependence    05034 Alcoholism     104987694  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104987694   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104987694 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104987694 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104987694 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104987694 NCBI-ProteinID:  XP_010837041 Ensembl:  ENSBBBG00000023194 UniProt:  A0A6P3H4X9 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtacgaagcagaccgcccgcaagtcgaccggtggcaaggccccgcggaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtcaagaagccgcat cgttataggccgggcaccgtggccctgcgggagattcggcgctaccagaagtcgaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggactttaag accgatctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgtttgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatc atgcccaaagacatccagctggctcgtcgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system