Bison bison bison (American bison): 104987778 Help Entry 104987778         CDS       T08726                                  Name (RefSeq) histone H2B type 1-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104987778  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104987778   09163 Immune disease    05322 Systemic lupus erythematosus     104987778   09165 Substance dependence    05034 Alcoholism     104987778  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104987778   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104987778 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104987778 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104987778 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  104987778 NCBI-ProteinID:  XP_010837146 UniProt:  A0A6P3H5F4 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPRKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGFSSKAM GIMNSFVNDIFKRIAGEASCLAHYNKRSTITSREIQTAVRLLLPGGLAKHAVSQGTKALT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggctaagtctgctcctgctcctagaaagggctctaaaaaagctgtgacc aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctattccgtg tacgtgtacaaggtgctgaagcaagttcatccggacactggcttctcgtccaaggccatg ggaatcatgaactcctttgtcaacgacattttcaagcgcatcgctggcgaggcatcgtgc ctggcgcattacaacaagcgctcgactatcacatccagggagatccagaccgccgtgcgc ttgctgctacctggggggctggccaagcacgccgtgtcccagggcactaaggctctcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system