Bison bison bison (American bison): 104987928 Help Entry 104987928         CDS       T08726                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05202   Transcriptional misregulation in cancer bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104987928  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     104987928   09163 Immune disease    05322 Systemic lupus erythematosus     104987928   09165 Substance dependence    05034 Alcoholism     104987928  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104987928   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104987928 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104987928 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104987928 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C Motif Other DBs NCBI-GeneID:  104987928 NCBI-ProteinID:  XP_010837325 Ensembl:  ENSBBBG00000016814 UniProt:  A0A6P3HFF7 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MARTKQTARKSTSGKAPRKQLATKAAHKSAPSTGRVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQSLVRKIAQDFKTDLRFQSAAIGALLEASEAYLVGLFEDTNLCAIRAKRVTI MPKDIQLA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccagtggtaaagcaccgaggaagcaa ctcgctacaaaagccgctcacaagagtgcgccctctactggacgggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagagtctggtgcggaaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgctggaggcgagtgaggcctac ctggttggcctttttgaagacaccaacctgtgtgctatccgtgccaaacgtgtaacaatt atgccaaaagacattcagctagcatga

DBGET integrated database retrieval system