Bison bison bison (American bison): 104989025 Help Entry 104989025         CDS       T08726                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism bbis  Bison bison bison (American bison) Pathway bbis04015   Rap1 signaling pathway bbis04810   Regulation of actin cytoskeleton bbis05014   Amyotrophic lateral sclerosis bbis05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     104989025 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104989025 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104989025 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     104989025 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     104989025 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbis04812]     104989025 (PFN4)    04147 Exosome [BR:bbis04147]     104989025 (PFN4) Membrane trafficking [BR:bbis04131]  Others   Actin-binding proteins    Others     104989025 (PFN4) Cytoskeleton proteins [BR:bbis04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104989025 (PFN4) Exosome [BR:bbis04147]  Exosomal proteins   Proteins found in most exosomes    104989025 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104989025 NCBI-ProteinID:  XP_010838852 Ensembl:  ENSBBBG00000018737 UniProt:  A0A6P3HHK9 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GKFVPNACLSLLW NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaagaaccctttgaaaaccaga agagaaggactgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggtaagtttgttcccaatgcctgtctttctttgctgtggtag

DBGET integrated database retrieval system