Bison bison bison (American bison): 104989915 Help Entry 104989915         CDS       T08726                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism bbis  Bison bison bison (American bison) Pathway bbis01521   EGFR tyrosine kinase inhibitor resistance bbis01524   Platinum drug resistance bbis04014   Ras signaling pathway bbis04064   NF-kappa B signaling pathway bbis04115   p53 signaling pathway bbis04137   Mitophagy - animal bbis04140   Autophagy - animal bbis04151   PI3K-Akt signaling pathway bbis04210   Apoptosis bbis04215   Apoptosis - multiple species bbis04621   NOD-like receptor signaling pathway bbis04630   JAK-STAT signaling pathway bbis05012   Parkinson disease bbis05014   Amyotrophic lateral sclerosis bbis05022   Pathways of neurodegeneration - multiple diseases bbis05145   Toxoplasmosis bbis05162   Measles bbis05166   Human T-cell leukemia virus 1 infection bbis05168   Herpes simplex virus 1 infection bbis05170   Human immunodeficiency virus 1 infection bbis05200   Pathways in cancer bbis05202   Transcriptional misregulation in cancer bbis05212   Pancreatic cancer bbis05220   Chronic myeloid leukemia bbis05222   Small cell lung cancer bbis05225   Hepatocellular carcinoma bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     104989915 (BCL2L1)    04630 JAK-STAT signaling pathway     104989915 (BCL2L1)    04064 NF-kappa B signaling pathway     104989915 (BCL2L1)    04151 PI3K-Akt signaling pathway     104989915 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104989915 (BCL2L1)    04137 Mitophagy - animal     104989915 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     104989915 (BCL2L1)    04215 Apoptosis - multiple species     104989915 (BCL2L1)    04115 p53 signaling pathway     104989915 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104989915 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104989915 (BCL2L1)    05202 Transcriptional misregulation in cancer     104989915 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     104989915 (BCL2L1)    05225 Hepatocellular carcinoma     104989915 (BCL2L1)    05220 Chronic myeloid leukemia     104989915 (BCL2L1)    05222 Small cell lung cancer     104989915 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     104989915 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     104989915 (BCL2L1)    05162 Measles     104989915 (BCL2L1)    05168 Herpes simplex virus 1 infection     104989915 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     104989915 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     104989915 (BCL2L1)    05014 Amyotrophic lateral sclerosis     104989915 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     104989915 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104989915 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     104989915 (BCL2L1)    01524 Platinum drug resistance     104989915 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbis01009]     104989915 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104989915 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bbis02000]     104989915 (BCL2L1) Protein phosphatases and associated proteins [BR:bbis01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      104989915 (BCL2L1) Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104989915 (BCL2L1) Transporters [BR:bbis02000]  Other transporters   Pores ion channels [TC:1]    104989915 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  104989915 NCBI-ProteinID:  XP_010840052 Ensembl:  ENSBBBG00000009958 UniProt:  A0A6P3HLK0 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLA DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system