Bison bison bison (American bison): 104990461 Help Entry 104990461         CDS       T08726                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism bbis  Bison bison bison (American bison) Pathway bbis04081   Hormone signaling bbis04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     104990461 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     104990461 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104990461 (GAST) Cytokines and neuropeptides [BR:bbis04052]  Neuropeptides   GPCR binding    104990461 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  104990461 NCBI-ProteinID:  XP_010840844 Ensembl:  ENSBBBG00000000082 UniProt:  A0A6P3HNS2 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCAHVLILVLALAAFCEASWKPHSHLQDAPVAPGANRGQEPLRMNRLGPASHPRRQL GLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgtgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaagccccactcccacctgcaagacgcgcccgtcgctccaggggccaatagg ggccaggagccgctcaggatgaaccggctgggcccagcctcgcacccccggaggcagctg gggcttcaggatccgccacacatggtcgcagacctgtccaagaagcaggggccatgggtg gaggaagaggaagcagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccctga

DBGET integrated database retrieval system