Bison bison bison (American bison): 104990691 Help Entry 104990691         CDS       T08726                                  Symbol UBB Name (RefSeq) polyubiquitin-B   KO K08770   ubiquitin B/C Organism bbis  Bison bison bison (American bison) Pathway bbis04120   Ubiquitin mediated proteolysis bbis04137   Mitophagy - animal bbis04140   Autophagy - animal bbis05012   Parkinson disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104990691 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104990691 (UBB)    04137 Mitophagy - animal     104990691 (UBB)  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     104990691 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     104990691 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     104990691 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     104990691 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bbis04121]     104990691 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104990691 (UBB) Ubiquitin system [BR:bbis04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    104990691 (UBB) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of breast milk    104990691 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    104990691 (UBB)   Exosomal proteins of colorectal cancer cells    104990691 (UBB)   Exosomal proteins of bladder cancer cells    104990691 (UBB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N UBL_UBAC1 WAR1_C Motif Other DBs NCBI-GeneID:  104990691 NCBI-ProteinID:  XP_010841268 UniProt:  A0A6P3HE63 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaaaaccctgaccggcaagaccatcaccctggaggtggagcccagt gacaccatcgagaacgtgaaggccaagatccaggataaggaaggcattccccctgaccag cagaggctcatctttgcaggcaagcagctggaagatggccgcactctttctgattacaac atccagaaagagtcgaccctgcacctggtcctccgtctgaggggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgag aacgtgaaggccaagatccaggataaggagggcattccccccgaccagcagaggctcatc tttgccggcaagcagctggaagatggccgcactctttctgattacaacatccagaaagag tcgaccctgcacctggtccttcgtctgaggggtggctgttaa

DBGET integrated database retrieval system