Bison bison bison (American bison): 104990840 Help Entry 104990840         CDS       T08726                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104990840  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104990840   09163 Immune disease    05322 Systemic lupus erythematosus     104990840   09165 Substance dependence    05034 Alcoholism     104990840  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104990840   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104990840 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104990840 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104990840 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone YscO-like CBFD_NFYB_HMF ARM_TT21 TFIID_20kDa CENP-T_C Motif Other DBs NCBI-GeneID:  104990840 NCBI-ProteinID:  XP_010841458 UniProt:  A0A6P3HER8 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MKVDGEKRFQNLSVLLGVVIIDMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESY SMYMYKELKQVHLDTGISSKAMGIMNSFINDIFERIGGEASRLAHYNKRSTITSREIQTA LRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaaggtggatggtgaaaagcgattccagaatctttctgtgttgttgggtgttgtcatt atagacatgcctgaaccggccaagtctgctcctgcccctaaaaagggctctaaaaaagct gtgaccaaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctac tccatgtacatgtacaaggagctgaagcaagtccatctggacaccggcatctcgtccaaa gccatgggaatcatgaactccttcatcaatgacattttcgagcgcatcggtggcgaggca tcgcgcctggcgcattacaacaagcgctcgactatcacctccagggagatccagactgcc ctgcgcttgctgctacctggggagctggccaagcacgccgtgtctgagggcactaaggct gtcaccaagtataccagctccaagtaa

DBGET integrated database retrieval system