Bison bison bison (American bison): 104991092 Help Entry 104991092         CDS       T08726                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05202   Transcriptional misregulation in cancer bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104991092  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     104991092   09163 Immune disease    05322 Systemic lupus erythematosus     104991092   09165 Substance dependence    05034 Alcoholism     104991092  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104991092   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104991092 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104991092 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104991092 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104991092 NCBI-ProteinID:  XP_010841742 Ensembl:  ENSBBBG00000025318 UniProt:  A0A6P3HQV3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcggactaagcagactgctcggaaatccactggcggcaaggccccgcgcaagcag ctggccaccaaagcagcccgtaagagcgcgccggccaccggcggtgtgaagaagcctcac cgctaccggcctggcaccgtggccctgcgcgagatccgccgctaccagaagtctacggag ctgctgatccgcaagctaccgttccagcggctggtgcgcgagatcgcacaggactttaag accgacctccgcttccagagctcggcggtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggcttttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagcttgcccgccggatccgcggggagagggcgtaa

DBGET integrated database retrieval system