Bison bison bison (American bison): 104991168 Help Entry 104991168         CDS       T08726                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism bbis  Bison bison bison (American bison) Pathway bbis04621   NOD-like receptor signaling pathway bbis05012   Parkinson disease bbis05132   Salmonella infection bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104991168 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104991168 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     104991168 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     104991168 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bbis03110]     104991168 (TXN) Chaperones and folding catalysts [BR:bbis03110]  Protein folding catalysts   Protein disulfide isomerase    104991168 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  104991168 NCBI-ProteinID:  XP_010841860 Ensembl:  ENSBBBG00000022850 UniProt:  A0A6P3HTI6 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaaacagattgagagcaagtacgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtagtcgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattctctctctgaaaagtattccaacgtggtgttcctcgaagtagatgtggat gactgtcaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaagaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system