Bison bison bison (American bison): 104992287 Help Entry 104992287         CDS       T08726                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism bbis  Bison bison bison (American bison) Pathway bbis04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104992287 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbis03037]     104992287 (CBY1) Cilium and associated proteins [BR:bbis03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    104992287 (CBY1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  104992287 NCBI-ProteinID:  XP_010843413 Ensembl:  ENSBBBG00000005188 UniProt:  A0A6P3HL15 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MPLFGSTFSPKKTPPRKSASLSNLHNLDRSTREVELGLDYGTPTMNLAGQSLKFENGQWI AETGISGGVDRREAQRLRRRRETSLSLNGLLFFFQLSETTAESHLMEKELDELKSVSRRR K NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcctctctttggaagtacgtttagtccgaagaagacgccccctcggaagtcggcctct ctctccaacctgcataatttggaccggtcaacgcgggaggtggaactgggccttgactac ggaacccccaccatgaacctggctgggcagagcctgaagtttgaaaatggccagtggata gcagagacggggattagtggcggtgtggaccggagggaggctcagcgcctgcggagacgc cgtgaaacgtccctgtcgcttaatggtttgctgttcttcttccagctctcagagaccact gctgaatcccacttaatggagaaagagctggatgaactgaagagcgtcagcaggcggaga aaatga

DBGET integrated database retrieval system