Bison bison bison (American bison): 104992445 Help Entry 104992445         CDS       T08726                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04020   Calcium signaling pathway bbis04022   cGMP-PKG signaling pathway bbis04114   Oocyte meiosis bbis04218   Cellular senescence bbis04310   Wnt signaling pathway bbis04360   Axon guidance bbis04370   VEGF signaling pathway bbis04380   Osteoclast differentiation bbis04625   C-type lectin receptor signaling pathway bbis04650   Natural killer cell mediated cytotoxicity bbis04658   Th1 and Th2 cell differentiation bbis04659   Th17 cell differentiation bbis04660   T cell receptor signaling pathway bbis04662   B cell receptor signaling pathway bbis04720   Long-term potentiation bbis04724   Glutamatergic synapse bbis04921   Oxytocin signaling pathway bbis04922   Glucagon signaling pathway bbis04924   Renin secretion bbis05010   Alzheimer disease bbis05014   Amyotrophic lateral sclerosis bbis05020   Prion disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05031   Amphetamine addiction bbis05152   Tuberculosis bbis05163   Human cytomegalovirus infection bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05170   Human immunodeficiency virus 1 infection bbis05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104992445 (PPP3R1)    04310 Wnt signaling pathway     104992445 (PPP3R1)    04370 VEGF signaling pathway     104992445 (PPP3R1)    04020 Calcium signaling pathway     104992445 (PPP3R1)    04022 cGMP-PKG signaling pathway     104992445 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104992445 (PPP3R1)    04218 Cellular senescence     104992445 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104992445 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     104992445 (PPP3R1)    04660 T cell receptor signaling pathway     104992445 (PPP3R1)    04658 Th1 and Th2 cell differentiation     104992445 (PPP3R1)    04659 Th17 cell differentiation     104992445 (PPP3R1)    04662 B cell receptor signaling pathway     104992445 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     104992445 (PPP3R1)    04921 Oxytocin signaling pathway     104992445 (PPP3R1)    04924 Renin secretion     104992445 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     104992445 (PPP3R1)    04720 Long-term potentiation     104992445 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     104992445 (PPP3R1)    04380 Osteoclast differentiation     104992445 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     104992445 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     104992445 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     104992445 (PPP3R1)    05163 Human cytomegalovirus infection     104992445 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     104992445 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     104992445 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     104992445 (PPP3R1)    05014 Amyotrophic lateral sclerosis     104992445 (PPP3R1)    05020 Prion disease     104992445 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     104992445 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     104992445 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104992445 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbis01009]     104992445 (PPP3R1) Protein phosphatases and associated proteins [BR:bbis01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104992445 (PPP3R1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  104992445 NCBI-ProteinID:  XP_010843632 Ensembl:  ENSBBBG00000004071 UniProt:  A0A6P3HWG1 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcacactttgatgcagatgaaattaaaaggctaggaaagagatttaagaagctc gatttggacaattctggttctttgagtgtggaagagttcatgtctctacctgagttacaa cagaatcccttagtacagcgagtaatagatatattcgacacagatgggaatggagaagta gactttaaagagttcattgagggagtctctcagttcagtgtcaaaggagataaggaacag aagttgaggtttgctttccgtatctatgacatggataaagacggctatatttccaatggg gaactcttccaggtgctaaagatgatggtggggaacaatctgaaagatacacagttacag caaattgtagacaaaaccataataaatgcagataaggatggggatggaagaatatccttt gaagaattctgtgctgttgtaggcggcctagatatccacaaaaagatggtggtagacgtg tga

DBGET integrated database retrieval system