Bison bison bison (American bison): 104993173 Help Entry 104993173         CDS       T08726                                  Name (RefSeq) histone H2B type 1-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104993173  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104993173   09163 Immune disease    05322 Systemic lupus erythematosus     104993173   09165 Substance dependence    05034 Alcoholism     104993173  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104993173   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104993173 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104993173 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104993173 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 TAF Motif Other DBs NCBI-GeneID:  104993173 NCBI-ProteinID:  XP_010844610 UniProt:  A0A6P3I196 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKSSRKESYWVYVYKALKQVHPDTGISSKAM GIMSSFVKDIFKRIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHTVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggctaagtctgctcctgcccctaaaaagggctctaaaaaagctgtgacc aaggcccagaagaaggacggcaagaagcgcaagagcagccgcaaggagagctactgggtg tatgtgtacaaggcactgaagcaagtccatccggacactggcatctcgtccaaggccatg ggaatcatgagctcctttgtcaaggacattttcaagcgcatagctggtgaggcatcacgc ctggcgcattacaacaagcgctcgactatcacatccagggagatccagaccgccgtgcgc ttgctgctacctggggagctggccaagcacaccgtgtccgagggcactaaggctgtcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system