Bison bison bison (American bison): 104993331 Help Entry 104993331         CDS       T08726                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism bbis  Bison bison bison (American bison) Pathway bbis04015   Rap1 signaling pathway bbis04810   Regulation of actin cytoskeleton bbis05014   Amyotrophic lateral sclerosis bbis05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     104993331 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104993331 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104993331 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     104993331 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     104993331 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbis04812]     104993331 (PFN3)    04147 Exosome [BR:bbis04147]     104993331 (PFN3) Membrane trafficking [BR:bbis04131]  Others   Actin-binding proteins    Others     104993331 (PFN3) Cytoskeleton proteins [BR:bbis04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104993331 (PFN3) Exosome [BR:bbis04147]  Exosomal proteins   Proteins found in most exosomes    104993331 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  104993331 NCBI-ProteinID:  XP_010844850 Ensembl:  ENSBBBG00000010757 UniProt:  A0A6P3I1T7 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg gccattgtgggccactcggacaatcgctgcgtgtgggcctcgaggcctgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcaccgggccagaccggagcaccttcctg caggccgggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggcg gagggggacggagtgctagacgcacgcaccaagggtctggacgggcgcgccatctgcgtg ggccacacgcctcgggcgcttctcgtgctcatgggccggcggggtgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgctcgcagggcacctag

DBGET integrated database retrieval system