Bison bison bison (American bison): 104994841 Help Entry 104994841         CDS       T08726                                  Name (RefSeq) histone H2B type 1-L-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104994841  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104994841   09163 Immune disease    05322 Systemic lupus erythematosus     104994841   09165 Substance dependence    05034 Alcoholism     104994841  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104994841   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104994841 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104994841 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104994841 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  104994841 NCBI-ProteinID:  XP_010846810 UniProt:  A0A6P3I7D3 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MPELAKSAPAPKKGSKKAVTKAQKKDGKKHKRSHKKNHSVYVYKEQALHPGLEAEGEEEE RVNDKARTTAQQSLSSPSLLSRELALTLLTPAIRPFPGASAFY NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcctgaactggctaagtctgctcctgcccctaaaaagggctctaaaaaagctgtgacc aaggcccaaaagaaggacggcaagaagcacaagcgcagccacaagaagaaccactctgtg tacgtgtacaaggagcaggctcttcaccccggactggaggcagaaggtgaggaagaggaa agagtaaatgacaaagcgagaactacagcccagcagtcgctctcctcgccctccctctta tcccgagaactagctctcaccctcctcacgcccgcaatccggcccttcccgggggccagc gccttttattga

DBGET integrated database retrieval system