Bison bison bison (American bison): 104995631 Help Entry 104995631         CDS       T08726                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism bbis  Bison bison bison (American bison) Pathway bbis01521   EGFR tyrosine kinase inhibitor resistance bbis01522   Endocrine resistance bbis01524   Platinum drug resistance bbis04071   Sphingolipid signaling pathway bbis04115   p53 signaling pathway bbis04141   Protein processing in endoplasmic reticulum bbis04210   Apoptosis bbis04211   Longevity regulating pathway bbis04215   Apoptosis - multiple species bbis04217   Necroptosis bbis04722   Neurotrophin signaling pathway bbis04932   Non-alcoholic fatty liver disease bbis04933   AGE-RAGE signaling pathway in diabetic complications bbis05012   Parkinson disease bbis05014   Amyotrophic lateral sclerosis bbis05016   Huntington disease bbis05020   Prion disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05132   Salmonella infection bbis05152   Tuberculosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05165   Human papillomavirus infection bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05200   Pathways in cancer bbis05202   Transcriptional misregulation in cancer bbis05203   Viral carcinogenesis bbis05210   Colorectal cancer bbis05212   Pancreatic cancer bbis05213   Endometrial cancer bbis05214   Glioma bbis05216   Thyroid cancer bbis05217   Basal cell carcinoma bbis05218   Melanoma bbis05220   Chronic myeloid leukemia bbis05222   Small cell lung cancer bbis05223   Non-small cell lung cancer bbis05224   Breast cancer bbis05225   Hepatocellular carcinoma bbis05226   Gastric cancer bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104995631 (BAX)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     104995631 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     104995631 (BAX)    04215 Apoptosis - multiple species     104995631 (BAX)    04217 Necroptosis     104995631 (BAX)    04115 p53 signaling pathway     104995631 (BAX)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     104995631 (BAX)   09149 Aging    04211 Longevity regulating pathway     104995631 (BAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104995631 (BAX)    05202 Transcriptional misregulation in cancer     104995631 (BAX)    05203 Viral carcinogenesis     104995631 (BAX)   09162 Cancer: specific types    05210 Colorectal cancer     104995631 (BAX)    05212 Pancreatic cancer     104995631 (BAX)    05225 Hepatocellular carcinoma     104995631 (BAX)    05226 Gastric cancer     104995631 (BAX)    05214 Glioma     104995631 (BAX)    05216 Thyroid cancer     104995631 (BAX)    05220 Chronic myeloid leukemia     104995631 (BAX)    05217 Basal cell carcinoma     104995631 (BAX)    05218 Melanoma     104995631 (BAX)    05213 Endometrial cancer     104995631 (BAX)    05224 Breast cancer     104995631 (BAX)    05222 Small cell lung cancer     104995631 (BAX)    05223 Non-small cell lung cancer     104995631 (BAX)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     104995631 (BAX)    05170 Human immunodeficiency virus 1 infection     104995631 (BAX)    05161 Hepatitis B     104995631 (BAX)    05160 Hepatitis C     104995631 (BAX)    05164 Influenza A     104995631 (BAX)    05162 Measles     104995631 (BAX)    05168 Herpes simplex virus 1 infection     104995631 (BAX)    05163 Human cytomegalovirus infection     104995631 (BAX)    05167 Kaposi sarcoma-associated herpesvirus infection     104995631 (BAX)    05169 Epstein-Barr virus infection     104995631 (BAX)    05165 Human papillomavirus infection     104995631 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     104995631 (BAX)    05152 Tuberculosis     104995631 (BAX)   09164 Neurodegenerative disease    05012 Parkinson disease     104995631 (BAX)    05014 Amyotrophic lateral sclerosis     104995631 (BAX)    05016 Huntington disease     104995631 (BAX)    05020 Prion disease     104995631 (BAX)    05022 Pathways of neurodegeneration - multiple diseases     104995631 (BAX)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104995631 (BAX)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     104995631 (BAX)    04933 AGE-RAGE signaling pathway in diabetic complications     104995631 (BAX)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     104995631 (BAX)    01524 Platinum drug resistance     104995631 (BAX)    01522 Endocrine resistance     104995631 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bbis03029]     104995631 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bbis02000]     104995631 (BAX) Mitochondrial biogenesis [BR:bbis03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     104995631 (BAX) Transporters [BR:bbis02000]  Other transporters   Pores ion channels [TC:1]    104995631 (BAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 TetR_C_30 CF222 Motif Other DBs NCBI-GeneID:  104995631 NCBI-ProteinID:  XP_010847886 Ensembl:  ENSBBBG00000010774 UniProt:  A0A6P3HZ75 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRM IAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGW TLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgaagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggg ggagagacacccgagctgggcttggagcaggtgccccaggatgcatccaccaagaagctg agcgagtgtctgaagcgcatcggagatgaattggacagtaacatggagctgcagaggatg atcgcagctgtggacacagactctccccgagaggtctttttccgagtggcggctgaaatg ttttccgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaa ctggtgctcaaggccctgtgcaccaaggtgcccgagttgatcaggaccatcatgggctgg acattggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggac ggcctcctctcctactttgggacacccacatggcagacagtgaccatctttgtggctgga gtgctcaccgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system