Bison bison bison (American bison): 104996941 Help Entry 104996941         CDS       T08726                                  Symbol NME3 Name (RefSeq) nucleoside diphosphate kinase 3   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism bbis  Bison bison bison (American bison) Pathway bbis00230   Purine metabolism bbis00240   Pyrimidine metabolism bbis00983   Drug metabolism - other enzymes bbis01100   Metabolic pathways bbis01232   Nucleotide metabolism bbis01240   Biosynthesis of cofactors Module bbis_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP bbis_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP bbis_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP bbis_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP bbis_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:bbis00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     104996941 (NME3)    00240 Pyrimidine metabolism     104996941 (NME3)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     104996941 (NME3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     104996941 (NME3) Enzymes [BR:bbis01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      104996941 (NME3) Membrane trafficking [BR:bbis04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     104996941 (NME3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  104996941 NCBI-ProteinID:  XP_010849639 UniProt:  A0A6P3ICT6 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MWLLLSLGLRDQSGLVAGLQGGTGCHCCLRPLVWQGLDVVRASRALIGATNPADATPGTI RGDFCIEVGKNVIHGSDSVESARREIALWFRTDELLCWEDSAGHWLYE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtggcttcttttgagtttggggttgagggaccaaagcgggctggtggcagggcttcag ggaggaacaggctgtcactgctgcttacggccgttggtgtggcagggtctggacgttgta cgcgcttcccgggcgctcatcggagccacgaatccggccgacgccacgcccggcaccatc cgcggcgatttctgcatcgaggtcggcaagaacgtgattcacggcagcgactcggtggag agcgctcgccgcgagatcgcactctggttccgcacagacgagctcctgtgctgggaggat agcgcggggcactggctgtacgagtag

DBGET integrated database retrieval system