Bison bison bison (American bison): 104997939 Help Entry 104997939         CDS       T08726                                  Name (RefSeq) histone H2B type 1-H-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104997939  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104997939   09163 Immune disease    05322 Systemic lupus erythematosus     104997939   09165 Substance dependence    05034 Alcoholism     104997939  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104997939   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104997939 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104997939 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104997939 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF ARM_TT21 YscO-like TFIID_20kDa CENP-T_C Motif Other DBs NCBI-GeneID:  104997939 NCBI-ProteinID:  XP_010851226 UniProt:  A0A6P3I9J9 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSEKAVTKAQKKDGKKRKHSPKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFINDIFERFAHEASRLAHYNKRSTITSQEIQTAVRLLLPGELAKQDVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccggccaagtctgctcctgcccctaaaaagggctctgaaaaagctgtgacc aaggcccagaagaaggacggcaagaagcgcaagcacagcccaaaggagagctactccgtg tacgtgtacaaggtgctgaagcaagtccatccggacacgggcatctcgtccaaggccatg ggaatcatgaactccttcatcaacgacattttcgagcgcttcgctcatgaggcatcgcgc ctggcgcattacaacaagcgctcgactatcacatcccaggagatccagaccgccgtgcgc ttgctgctacctggggagctggccaagcaagacgtgtccgagggcactaaggctgtcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system