Bison bison bison (American bison): 104998269 Help Entry 104998269         CDS       T08726                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104998269  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104998269   09163 Immune disease    05322 Systemic lupus erythematosus     104998269   09165 Substance dependence    05034 Alcoholism     104998269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104998269   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104998269 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104998269 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104998269 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone LonB_AAA-LID CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  104998269 NCBI-ProteinID:  XP_010851650 UniProt:  A0A6P3IKW8 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MNVAPCPHRIYSVVGANDKYKYTSANISWQLIEQPLVVSLLLMHVALPRVAVNYSQLPPL LLEDQVHPDTSISSKAMGITNSFVNYIFKRIAGEASHLAHYNKSSTITSREIQTAMRLLL PGELAKHAVSEGTKAVTKYTSSK NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgaatgtggccccttgccctcatagaatttacagtgtagttggtgctaatgacaaatat aaatacacaagtgccaatatctcctggcagctcattgagcagccactcgttgtcagcctc cttctgatgcacgtggcactcccccgagtagctgtaaactattctcagctgcctcctcta cttctggaggatcaagtccatccggacactagcatctcgtccaaggccatgggaatcacg aactcctttgtcaattacattttcaagcgcatcgctggcgaggcatcacacctggcgcat tacaacaagagctcgactatcacatccagagagatccagaccgccatgcgcttgctgcta cctggggagctggccaagcatgctgtgtccgagggcactaaggctgtcaccaagtatacc agctccaagtaa

DBGET integrated database retrieval system