Bison bison bison (American bison): 105000175 Help Entry 105000175         CDS       T08726                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism bbis  Bison bison bison (American bison) Pathway bbis01522   Endocrine resistance bbis04010   MAPK signaling pathway bbis04012   ErbB signaling pathway bbis04024   cAMP signaling pathway bbis04137   Mitophagy - animal bbis04210   Apoptosis bbis04310   Wnt signaling pathway bbis04380   Osteoclast differentiation bbis04510   Focal adhesion bbis04530   Tight junction bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04625   C-type lectin receptor signaling pathway bbis04657   IL-17 signaling pathway bbis04658   Th1 and Th2 cell differentiation bbis04659   Th17 cell differentiation bbis04660   T cell receptor signaling pathway bbis04662   B cell receptor signaling pathway bbis04668   TNF signaling pathway bbis04722   Neurotrophin signaling pathway bbis04912   GnRH signaling pathway bbis04915   Estrogen signaling pathway bbis04921   Oxytocin signaling pathway bbis04926   Relaxin signaling pathway bbis04932   Non-alcoholic fatty liver disease bbis04933   AGE-RAGE signaling pathway in diabetic complications bbis05030   Cocaine addiction bbis05031   Amphetamine addiction bbis05132   Salmonella infection bbis05133   Pertussis bbis05135   Yersinia infection bbis05140   Leishmaniasis bbis05142   Chagas disease bbis05161   Hepatitis B bbis05162   Measles bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05200   Pathways in cancer bbis05203   Viral carcinogenesis bbis05207   Chemical carcinogenesis - receptor activation bbis05208   Chemical carcinogenesis - reactive oxygen species bbis05210   Colorectal cancer bbis05211   Renal cell carcinoma bbis05224   Breast cancer bbis05231   Choline metabolism in cancer bbis05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbis05321   Inflammatory bowel disease bbis05323   Rheumatoid arthritis bbis05417   Lipid and atherosclerosis bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105000175 (JUN)    04012 ErbB signaling pathway     105000175 (JUN)    04310 Wnt signaling pathway     105000175 (JUN)    04668 TNF signaling pathway     105000175 (JUN)    04024 cAMP signaling pathway     105000175 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105000175 (JUN)   09143 Cell growth and death    04210 Apoptosis     105000175 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105000175 (JUN)    04530 Tight junction     105000175 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105000175 (JUN)    04621 NOD-like receptor signaling pathway     105000175 (JUN)    04625 C-type lectin receptor signaling pathway     105000175 (JUN)    04660 T cell receptor signaling pathway     105000175 (JUN)    04658 Th1 and Th2 cell differentiation     105000175 (JUN)    04659 Th17 cell differentiation     105000175 (JUN)    04657 IL-17 signaling pathway     105000175 (JUN)    04662 B cell receptor signaling pathway     105000175 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     105000175 (JUN)    04915 Estrogen signaling pathway     105000175 (JUN)    04921 Oxytocin signaling pathway     105000175 (JUN)    04926 Relaxin signaling pathway     105000175 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     105000175 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     105000175 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105000175 (JUN)    05207 Chemical carcinogenesis - receptor activation     105000175 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     105000175 (JUN)    05203 Viral carcinogenesis     105000175 (JUN)    05231 Choline metabolism in cancer     105000175 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105000175 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     105000175 (JUN)    05211 Renal cell carcinoma     105000175 (JUN)    05224 Breast cancer     105000175 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105000175 (JUN)    05170 Human immunodeficiency virus 1 infection     105000175 (JUN)    05161 Hepatitis B     105000175 (JUN)    05171 Coronavirus disease - COVID-19     105000175 (JUN)    05162 Measles     105000175 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     105000175 (JUN)    05169 Epstein-Barr virus infection     105000175 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     105000175 (JUN)    05135 Yersinia infection     105000175 (JUN)    05133 Pertussis     105000175 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105000175 (JUN)    05142 Chagas disease     105000175 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     105000175 (JUN)    05321 Inflammatory bowel disease     105000175 (JUN)   09165 Substance dependence    05030 Cocaine addiction     105000175 (JUN)    05031 Amphetamine addiction     105000175 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105000175 (JUN)    05418 Fluid shear stress and atherosclerosis     105000175 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105000175 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     105000175 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105000175 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbis03000]     105000175 (JUN) Transcription factors [BR:bbis03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     105000175 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 ATG16 DUF3450 FlaC_arch Fib_alpha Motif Other DBs NCBI-GeneID:  105000175 NCBI-ProteinID:  XP_010854181 UniProt:  A0A6P3IIG9 LinkDB All DBs Position Unknown AA seq 320 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGS LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQXXXXXEEPQTVPEMPGETPPLSPIDMESQE RIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQK VMNHVNSGCQLMLTQQLQTF NT seq 963 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctaatc atacagtccagcaacgggcatatcaccaccacgccgacccctacccagttcctgtgcccc aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcctggtggccccggcggtggcctcggtggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggctcg ctgagcagcggcggcggggcgccctcctacggcgcggctggcctggcctttcccgcgcag ccccagcagcagcagcagcaaccgccgcagnnnnnnnnnnnnnnggaggagccgcagacg gtgcccgagatgcccggggaaacgccgcccctgtcccccatcgacatggagtcccaggag cggatcaaggcagagaggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaa aggaagctggagaggatcgcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaac tcggagctggcgtccacggccaatatgctcagggaacaggtggcccagcttaaacagaaa gtcatgaaccacgttaacagcgggtgccaactcatgctaacgcagcagttgcaaacgttt tga

DBGET integrated database retrieval system