KEGG   Bison bison bison (American bison): 105000225
Entry
105000225         CDS       T08726                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
bbis  Bison bison bison (American bison)
Pathway
bbis01521  EGFR tyrosine kinase inhibitor resistance
bbis01522  Endocrine resistance
bbis04010  MAPK signaling pathway
bbis04012  ErbB signaling pathway
bbis04014  Ras signaling pathway
bbis04015  Rap1 signaling pathway
bbis04062  Chemokine signaling pathway
bbis04068  FoxO signaling pathway
bbis04071  Sphingolipid signaling pathway
bbis04072  Phospholipase D signaling pathway
bbis04137  Mitophagy - animal
bbis04140  Autophagy - animal
bbis04150  mTOR signaling pathway
bbis04151  PI3K-Akt signaling pathway
bbis04210  Apoptosis
bbis04211  Longevity regulating pathway
bbis04213  Longevity regulating pathway - multiple species
bbis04218  Cellular senescence
bbis04360  Axon guidance
bbis04370  VEGF signaling pathway
bbis04371  Apelin signaling pathway
bbis04540  Gap junction
bbis04550  Signaling pathways regulating pluripotency of stem cells
bbis04625  C-type lectin receptor signaling pathway
bbis04650  Natural killer cell mediated cytotoxicity
bbis04660  T cell receptor signaling pathway
bbis04662  B cell receptor signaling pathway
bbis04664  Fc epsilon RI signaling pathway
bbis04714  Thermogenesis
bbis04720  Long-term potentiation
bbis04722  Neurotrophin signaling pathway
bbis04725  Cholinergic synapse
bbis04726  Serotonergic synapse
bbis04730  Long-term depression
bbis04810  Regulation of actin cytoskeleton
bbis04910  Insulin signaling pathway
bbis04912  GnRH signaling pathway
bbis04914  Progesterone-mediated oocyte maturation
bbis04915  Estrogen signaling pathway
bbis04916  Melanogenesis
bbis04917  Prolactin signaling pathway
bbis04919  Thyroid hormone signaling pathway
bbis04921  Oxytocin signaling pathway
bbis04926  Relaxin signaling pathway
bbis04929  GnRH secretion
bbis04933  AGE-RAGE signaling pathway in diabetic complications
bbis04935  Growth hormone synthesis, secretion and action
bbis04960  Aldosterone-regulated sodium reabsorption
bbis05010  Alzheimer disease
bbis05022  Pathways of neurodegeneration - multiple diseases
bbis05034  Alcoholism
bbis05160  Hepatitis C
bbis05161  Hepatitis B
bbis05163  Human cytomegalovirus infection
bbis05165  Human papillomavirus infection
bbis05166  Human T-cell leukemia virus 1 infection
bbis05167  Kaposi sarcoma-associated herpesvirus infection
bbis05170  Human immunodeficiency virus 1 infection
bbis05200  Pathways in cancer
bbis05203  Viral carcinogenesis
bbis05205  Proteoglycans in cancer
bbis05206  MicroRNAs in cancer
bbis05207  Chemical carcinogenesis - receptor activation
bbis05208  Chemical carcinogenesis - reactive oxygen species
bbis05210  Colorectal cancer
bbis05211  Renal cell carcinoma
bbis05212  Pancreatic cancer
bbis05213  Endometrial cancer
bbis05214  Glioma
bbis05215  Prostate cancer
bbis05216  Thyroid cancer
bbis05218  Melanoma
bbis05219  Bladder cancer
bbis05220  Chronic myeloid leukemia
bbis05221  Acute myeloid leukemia
bbis05223  Non-small cell lung cancer
bbis05224  Breast cancer
bbis05225  Hepatocellular carcinoma
bbis05226  Gastric cancer
bbis05230  Central carbon metabolism in cancer
bbis05231  Choline metabolism in cancer
bbis05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbis05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbis00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105000225 (KRAS)
   04012 ErbB signaling pathway
    105000225 (KRAS)
   04014 Ras signaling pathway
    105000225 (KRAS)
   04015 Rap1 signaling pathway
    105000225 (KRAS)
   04370 VEGF signaling pathway
    105000225 (KRAS)
   04371 Apelin signaling pathway
    105000225 (KRAS)
   04068 FoxO signaling pathway
    105000225 (KRAS)
   04072 Phospholipase D signaling pathway
    105000225 (KRAS)
   04071 Sphingolipid signaling pathway
    105000225 (KRAS)
   04151 PI3K-Akt signaling pathway
    105000225 (KRAS)
   04150 mTOR signaling pathway
    105000225 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105000225 (KRAS)
   04137 Mitophagy - animal
    105000225 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105000225 (KRAS)
   04218 Cellular senescence
    105000225 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105000225 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105000225 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105000225 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105000225 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    105000225 (KRAS)
   04660 T cell receptor signaling pathway
    105000225 (KRAS)
   04662 B cell receptor signaling pathway
    105000225 (KRAS)
   04664 Fc epsilon RI signaling pathway
    105000225 (KRAS)
   04062 Chemokine signaling pathway
    105000225 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105000225 (KRAS)
   04929 GnRH secretion
    105000225 (KRAS)
   04912 GnRH signaling pathway
    105000225 (KRAS)
   04915 Estrogen signaling pathway
    105000225 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    105000225 (KRAS)
   04917 Prolactin signaling pathway
    105000225 (KRAS)
   04921 Oxytocin signaling pathway
    105000225 (KRAS)
   04926 Relaxin signaling pathway
    105000225 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    105000225 (KRAS)
   04919 Thyroid hormone signaling pathway
    105000225 (KRAS)
   04916 Melanogenesis
    105000225 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105000225 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105000225 (KRAS)
   04726 Serotonergic synapse
    105000225 (KRAS)
   04720 Long-term potentiation
    105000225 (KRAS)
   04730 Long-term depression
    105000225 (KRAS)
   04722 Neurotrophin signaling pathway
    105000225 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105000225 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105000225 (KRAS)
   04213 Longevity regulating pathway - multiple species
    105000225 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105000225 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105000225 (KRAS)
   05206 MicroRNAs in cancer
    105000225 (KRAS)
   05205 Proteoglycans in cancer
    105000225 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    105000225 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105000225 (KRAS)
   05203 Viral carcinogenesis
    105000225 (KRAS)
   05230 Central carbon metabolism in cancer
    105000225 (KRAS)
   05231 Choline metabolism in cancer
    105000225 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105000225 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105000225 (KRAS)
   05212 Pancreatic cancer
    105000225 (KRAS)
   05225 Hepatocellular carcinoma
    105000225 (KRAS)
   05226 Gastric cancer
    105000225 (KRAS)
   05214 Glioma
    105000225 (KRAS)
   05216 Thyroid cancer
    105000225 (KRAS)
   05221 Acute myeloid leukemia
    105000225 (KRAS)
   05220 Chronic myeloid leukemia
    105000225 (KRAS)
   05218 Melanoma
    105000225 (KRAS)
   05211 Renal cell carcinoma
    105000225 (KRAS)
   05219 Bladder cancer
    105000225 (KRAS)
   05215 Prostate cancer
    105000225 (KRAS)
   05213 Endometrial cancer
    105000225 (KRAS)
   05224 Breast cancer
    105000225 (KRAS)
   05223 Non-small cell lung cancer
    105000225 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105000225 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    105000225 (KRAS)
   05161 Hepatitis B
    105000225 (KRAS)
   05160 Hepatitis C
    105000225 (KRAS)
   05163 Human cytomegalovirus infection
    105000225 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105000225 (KRAS)
   05165 Human papillomavirus infection
    105000225 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105000225 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105000225 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    105000225 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105000225 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105000225 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105000225 (KRAS)
   01522 Endocrine resistance
    105000225 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbis04131]
    105000225 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bbis04031]
    105000225 (KRAS)
Membrane trafficking [BR:bbis04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105000225 (KRAS)
GTP-binding proteins [BR:bbis04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105000225 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 105000225
NCBI-ProteinID: XP_010854295
Ensembl: ENSBBBG00000010586
UniProt: A0A6P3IT10
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system