Bison bison bison (American bison): 105000723 Help Entry 105000723         CDS       T08726                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism bbis  Bison bison bison (American bison) Pathway bbis04014   Ras signaling pathway bbis04137   Mitophagy - animal bbis04144   Endocytosis bbis04145   Phagosome bbis04148   Efferocytosis bbis04962   Vasopressin-regulated water reabsorption bbis05014   Amyotrophic lateral sclerosis bbis05022   Pathways of neurodegeneration - multiple diseases bbis05132   Salmonella infection bbis05146   Amoebiasis bbis05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105000723 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105000723 (RAB5A)    04145 Phagosome     105000723 (RAB5A)    04137 Mitophagy - animal     105000723 (RAB5A)    04148 Efferocytosis     105000723 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     105000723 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105000723 (RAB5A)    05152 Tuberculosis     105000723 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     105000723 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105000723 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     105000723 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     105000723 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     105000723 (RAB5A)    04031 GTP-binding proteins [BR:bbis04031]     105000723 (RAB5A) Membrane trafficking [BR:bbis04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     105000723 (RAB5A)  Endosome - Lysosome transport     105000723 (RAB5A) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105000723 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    105000723 (RAB5A)   Exosomal proteins of colorectal cancer cells    105000723 (RAB5A)   Exosomal proteins of bladder cancer cells    105000723 (RAB5A) GTP-binding proteins [BR:bbis04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     105000723 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  105000723 NCBI-ProteinID:  XP_010855010 Ensembl:  ENSBBBG00000010394 UniProt:  A0A6P3IV13 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSTRGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccattggggctgcttttctaactcaa acagtatgtcttgacgacacgacagtaaaatttgaaatatgggatacggctggccaagag cggtaccacagcctggcgcccatgtactacagaggcgcccaggccgccatagtcgtgtac gacatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgtcgactttcaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctaccagaggaagaggagtagac ctcaccgagcccacacagcccaccaggagtcagtgctgtagtaactaa

DBGET integrated database retrieval system