Bison bison bison (American bison): 105001186 Help Entry 105001186         CDS       T08726                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105001186  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105001186   09163 Immune disease    05322 Systemic lupus erythematosus     105001186   09165 Substance dependence    05034 Alcoholism     105001186  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     105001186   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     105001186 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105001186 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105001186 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF CENP-T_C DUF6246 YscO-like Motif Other DBs NCBI-GeneID:  105001186 NCBI-ProteinID:  XP_010855662 Ensembl:  ENSBBBG00000001354 UniProt:  A0A6P3IW31 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MSAEHGQLQQSGGRRGRSPGDKKSRRRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIMN SFVNDLFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgagcacggacagctgcagcagtctgggggccggcgcggccggagtcctggg gacaagaagtccagaaggcgcagccggcgcaaagaaacctactccatgtacatctataag gtgctgaagcaggtgcaccccgacatcggcatctcctccaaggccatgagcatcatgaac tcgttcgtgaacgatctgtttgagcggctggccggtgaggccgcccggctggcccagtac tcaggccgaaccacactgacgtcccgggaggtccagacggccgtgcgtctgctgctgcct ggggagctggccaagcacgctgtgtccgagggcaccaaggccgtgaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system