Bison bison bison (American bison): 105001286 Help Entry 105001286         CDS       T08726                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism bbis  Bison bison bison (American bison) Pathway bbis04382   Cornified envelope formation bbis05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105001286 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105001286 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     105001286 (S100A10) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of microglial cells    105001286 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  105001286 NCBI-ProteinID:  XP_010855770 Ensembl:  ENSBBBG00000013878 UniProt:  A0A6P3IXE0 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggagcacgccatggaaaccatgatgttcacatttcacaaatttgca ggtgataaaggttacttaacaaaggaagacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctggac cagtgtcgagacggcaaagtgggcttccagagcttcttttcgctaatcgctgggctcacc atcgcatgcaatgactattttgtagtacacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system