Bison bison bison (American bison): 105001805 Help Entry 105001805         CDS       T08726                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04014   Ras signaling pathway bbis04015   Rap1 signaling pathway bbis04072   Phospholipase D signaling pathway bbis04137   Mitophagy - animal bbis04140   Autophagy - animal bbis04218   Cellular senescence bbis04371   Apelin signaling pathway bbis04625   C-type lectin receptor signaling pathway bbis04810   Regulation of actin cytoskeleton bbis05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105001805 (MRAS)    04014 Ras signaling pathway     105001805 (MRAS)    04015 Rap1 signaling pathway     105001805 (MRAS)    04371 Apelin signaling pathway     105001805 (MRAS)    04072 Phospholipase D signaling pathway     105001805 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105001805 (MRAS)    04137 Mitophagy - animal     105001805 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     105001805 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105001805 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105001805 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105001805 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bbis04031]     105001805 (MRAS) GTP-binding proteins [BR:bbis04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105001805 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  105001805 NCBI-ProteinID:  XP_010856522 Ensembl:  ENSBBBG00000015926 UniProt:  A0A6P3IQI5 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaacgagtgcagtccccagcgacaacctccccacgtacaagctggtggtggtggga gatgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct gactatgaccccaccatcgaagactcctacctgaaacatacagagattgacaatcaatgg gccatcttggacgttctggacacagccggacaggaggagttcagcgccatgcgggagcag tacatgcgcacaggggacggcttcctcatcgtcttctcggtcacggacaaggccagcttc gagcacgtggaccgcttccaccagctcatccttcgcgtcaaggacagggagtcattcccg atgatcctcgtggccaacaaggtcgatctgatgcatttgaggaaaatcaccagggaacaa ggaaaagaaatggcaaccaaacacaatattccgtacatagaaaccagtgccaaggaccca cctctcaacgtcgacaaagccttccacgacctggttagagtaattaggcagcagattccg gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccacgggcacc cacaaactgcagtgcgtgatattgtga

DBGET integrated database retrieval system