Bison bison bison (American bison): 105001836 Help Entry 105001836         CDS       T08726                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism bbis  Bison bison bison (American bison) Pathway bbis04015   Rap1 signaling pathway bbis04810   Regulation of actin cytoskeleton bbis05014   Amyotrophic lateral sclerosis bbis05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105001836 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105001836 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105001836 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105001836 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     105001836 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbis04812]     105001836 (PFN2)    04147 Exosome [BR:bbis04147]     105001836 (PFN2) Membrane trafficking [BR:bbis04131]  Others   Actin-binding proteins    Others     105001836 (PFN2) Cytoskeleton proteins [BR:bbis04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105001836 (PFN2) Exosome [BR:bbis04147]  Exosomal proteins   Proteins found in most exosomes    105001836 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105001836 NCBI-ProteinID:  XP_010856589 UniProt:  A0A6P3IWJ6 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search LQLFVLFSLSLSLFFCGWGWGQPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDG DCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV NT seq 357 nt NT seq  +upstreamnt  +downstreamnt ctacaactttttgttttgttttctctctctctctctctttttttttgtggttgggggtgg gggcagccagtagaaatagatatgattgtaggaaaagaccgggaaggtttctttaccaat ggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtggacggt gactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaacgtggcc gtgggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccacggaggc acacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtgtaa

DBGET integrated database retrieval system