Bison bison bison (American bison): 105001963 Help Entry 105001963         CDS       T08726                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04014   Ras signaling pathway bbis04015   Rap1 signaling pathway bbis04020   Calcium signaling pathway bbis04151   PI3K-Akt signaling pathway bbis04810   Regulation of actin cytoskeleton bbis05200   Pathways in cancer bbis05207   Chemical carcinogenesis - receptor activation bbis05218   Melanoma bbis05224   Breast cancer bbis05226   Gastric cancer Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105001963 (FGF20)    04014 Ras signaling pathway     105001963 (FGF20)    04015 Rap1 signaling pathway     105001963 (FGF20)    04020 Calcium signaling pathway     105001963 (FGF20)    04151 PI3K-Akt signaling pathway     105001963 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105001963 (FGF20)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105001963 (FGF20)    05207 Chemical carcinogenesis - receptor activation     105001963 (FGF20)   09162 Cancer: specific types    05226 Gastric cancer     105001963 (FGF20)    05218 Melanoma     105001963 (FGF20)    05224 Breast cancer     105001963 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105001963 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:bbis00536]     105001963 (FGF20) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Growth factors (RTK binding)    105001963 (FGF20) Glycosaminoglycan binding proteins [BR:bbis00536]  Heparan sulfate / Heparin   Growth factors/receptors    105001963 (FGF20) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  105001963 NCBI-ProteinID:  XP_010856702 UniProt:  A0A6P3IYZ9 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MVHIYTVVDLKTRRRGEGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECI FREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPE RVPELYKDLLMYS NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggtacacatttatactgtcgtggatcttaagacaaggcgaaggggtgaaggtatcctg gaattcatcagtgtggcagtgggacttgtcagtattagaggtgtggacagtggtctttac cttggaatgaatgacaaaggagaactatatggatcagagaaactgacttctgaatgcatc tttagggagcaatttgaagagaactggtataatacctattcatcgaacatatataaacac ggagacactggccgcaggtattttgtggcacttaacaaagacggaactccaagagatggt gccaggtccaaaagacatcagaaatttacacatttcctgcctagaccagtggatccagaa agagttcctgaactgtacaaggacctacttatgtacagttga

DBGET integrated database retrieval system