Bison bison bison (American bison): 105003125 Help Entry 105003125         CDS       T08726                                  Name (RefSeq) interferon alpha-1   KO K05414   interferon alpha Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04151   PI3K-Akt signaling pathway bbis04217   Necroptosis bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04630   JAK-STAT signaling pathway bbis04650   Natural killer cell mediated cytotoxicity bbis04936   Alcoholic liver disease bbis05152   Tuberculosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05165   Human papillomavirus infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05200   Pathways in cancer bbis05320   Autoimmune thyroid disease bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105003125    04151 PI3K-Akt signaling pathway     105003125   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105003125  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105003125  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105003125    04621 NOD-like receptor signaling pathway     105003125    04622 RIG-I-like receptor signaling pathway     105003125    04623 Cytosolic DNA-sensing pathway     105003125    04650 Natural killer cell mediated cytotoxicity     105003125  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105003125   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105003125    05161 Hepatitis B     105003125    05160 Hepatitis C     105003125    05171 Coronavirus disease - COVID-19     105003125    05164 Influenza A     105003125    05162 Measles     105003125    05168 Herpes simplex virus 1 infection     105003125    05163 Human cytomegalovirus infection     105003125    05167 Kaposi sarcoma-associated herpesvirus infection     105003125    05169 Epstein-Barr virus infection     105003125    05165 Human papillomavirus infection     105003125   09171 Infectious disease: bacterial    05152 Tuberculosis     105003125   09163 Immune disease    05320 Autoimmune thyroid disease     105003125   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105003125   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105003125  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105003125 Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interferons    105003125 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105003125 NCBI-ProteinID:  XP_010858409 Ensembl:  ENSBBBG00000023001 UniProt:  A0A6P3J160 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHQHHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDESLLDKLRTALDQQLTDLQ FCLRQEEGLPGAPLLNEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccctcctcctggctctgctgctgctcagctgcaacgccatctgc tctctgggctgccaccagcatcactcccacagcctggccaagaggagagtcctgacactc ctgagacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcactgggtggcagccagttgcagaaggctcaagccatctctgtactc cacgaggtgacccaacacaccttccagcttttcagcacagagggctcggccgctgcgtgg gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa ttctgtctgaggcaggaggaggggctgccaggggctcccctactcaacgaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system