Bison bison bison (American bison): 105003692 Help Entry 105003692         CDS       T08726                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism bbis  Bison bison bison (American bison) Pathway bbis01521   EGFR tyrosine kinase inhibitor resistance bbis01522   Endocrine resistance bbis04010   MAPK signaling pathway bbis04012   ErbB signaling pathway bbis04014   Ras signaling pathway bbis04015   Rap1 signaling pathway bbis04062   Chemokine signaling pathway bbis04068   FoxO signaling pathway bbis04071   Sphingolipid signaling pathway bbis04072   Phospholipase D signaling pathway bbis04137   Mitophagy - animal bbis04140   Autophagy - animal bbis04144   Endocytosis bbis04150   mTOR signaling pathway bbis04151   PI3K-Akt signaling pathway bbis04210   Apoptosis bbis04211   Longevity regulating pathway bbis04213   Longevity regulating pathway - multiple species bbis04218   Cellular senescence bbis04360   Axon guidance bbis04370   VEGF signaling pathway bbis04371   Apelin signaling pathway bbis04510   Focal adhesion bbis04540   Gap junction bbis04550   Signaling pathways regulating pluripotency of stem cells bbis04625   C-type lectin receptor signaling pathway bbis04630   JAK-STAT signaling pathway bbis04650   Natural killer cell mediated cytotoxicity bbis04660   T cell receptor signaling pathway bbis04662   B cell receptor signaling pathway bbis04664   Fc epsilon RI signaling pathway bbis04714   Thermogenesis bbis04720   Long-term potentiation bbis04722   Neurotrophin signaling pathway bbis04725   Cholinergic synapse bbis04726   Serotonergic synapse bbis04730   Long-term depression bbis04810   Regulation of actin cytoskeleton bbis04910   Insulin signaling pathway bbis04912   GnRH signaling pathway bbis04915   Estrogen signaling pathway bbis04916   Melanogenesis bbis04917   Prolactin signaling pathway bbis04919   Thyroid hormone signaling pathway bbis04921   Oxytocin signaling pathway bbis04926   Relaxin signaling pathway bbis04929   GnRH secretion bbis04933   AGE-RAGE signaling pathway in diabetic complications bbis04935   Growth hormone synthesis, secretion and action bbis05010   Alzheimer disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05034   Alcoholism bbis05132   Salmonella infection bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05163   Human cytomegalovirus infection bbis05165   Human papillomavirus infection bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05170   Human immunodeficiency virus 1 infection bbis05200   Pathways in cancer bbis05203   Viral carcinogenesis bbis05205   Proteoglycans in cancer bbis05206   MicroRNAs in cancer bbis05207   Chemical carcinogenesis - receptor activation bbis05208   Chemical carcinogenesis - reactive oxygen species bbis05210   Colorectal cancer bbis05211   Renal cell carcinoma bbis05213   Endometrial cancer bbis05214   Glioma bbis05215   Prostate cancer bbis05216   Thyroid cancer bbis05218   Melanoma bbis05219   Bladder cancer bbis05220   Chronic myeloid leukemia bbis05221   Acute myeloid leukemia bbis05223   Non-small cell lung cancer bbis05224   Breast cancer bbis05225   Hepatocellular carcinoma bbis05226   Gastric cancer bbis05230   Central carbon metabolism in cancer bbis05231   Choline metabolism in cancer bbis05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105003692 (HRAS)    04012 ErbB signaling pathway     105003692 (HRAS)    04014 Ras signaling pathway     105003692 (HRAS)    04015 Rap1 signaling pathway     105003692 (HRAS)    04370 VEGF signaling pathway     105003692 (HRAS)    04371 Apelin signaling pathway     105003692 (HRAS)    04630 JAK-STAT signaling pathway     105003692 (HRAS)    04068 FoxO signaling pathway     105003692 (HRAS)    04072 Phospholipase D signaling pathway     105003692 (HRAS)    04071 Sphingolipid signaling pathway     105003692 (HRAS)    04151 PI3K-Akt signaling pathway     105003692 (HRAS)    04150 mTOR signaling pathway     105003692 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105003692 (HRAS)    04140 Autophagy - animal     105003692 (HRAS)    04137 Mitophagy - animal     105003692 (HRAS)   09143 Cell growth and death    04210 Apoptosis     105003692 (HRAS)    04218 Cellular senescence     105003692 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105003692 (HRAS)    04540 Gap junction     105003692 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     105003692 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105003692 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105003692 (HRAS)    04650 Natural killer cell mediated cytotoxicity     105003692 (HRAS)    04660 T cell receptor signaling pathway     105003692 (HRAS)    04662 B cell receptor signaling pathway     105003692 (HRAS)    04664 Fc epsilon RI signaling pathway     105003692 (HRAS)    04062 Chemokine signaling pathway     105003692 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     105003692 (HRAS)    04929 GnRH secretion     105003692 (HRAS)    04912 GnRH signaling pathway     105003692 (HRAS)    04915 Estrogen signaling pathway     105003692 (HRAS)    04917 Prolactin signaling pathway     105003692 (HRAS)    04921 Oxytocin signaling pathway     105003692 (HRAS)    04926 Relaxin signaling pathway     105003692 (HRAS)    04935 Growth hormone synthesis, secretion and action     105003692 (HRAS)    04919 Thyroid hormone signaling pathway     105003692 (HRAS)    04916 Melanogenesis     105003692 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     105003692 (HRAS)    04726 Serotonergic synapse     105003692 (HRAS)    04720 Long-term potentiation     105003692 (HRAS)    04730 Long-term depression     105003692 (HRAS)    04722 Neurotrophin signaling pathway     105003692 (HRAS)   09158 Development and regeneration    04360 Axon guidance     105003692 (HRAS)   09149 Aging    04211 Longevity regulating pathway     105003692 (HRAS)    04213 Longevity regulating pathway - multiple species     105003692 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     105003692 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105003692 (HRAS)    05206 MicroRNAs in cancer     105003692 (HRAS)    05205 Proteoglycans in cancer     105003692 (HRAS)    05207 Chemical carcinogenesis - receptor activation     105003692 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     105003692 (HRAS)    05203 Viral carcinogenesis     105003692 (HRAS)    05230 Central carbon metabolism in cancer     105003692 (HRAS)    05231 Choline metabolism in cancer     105003692 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105003692 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     105003692 (HRAS)    05225 Hepatocellular carcinoma     105003692 (HRAS)    05226 Gastric cancer     105003692 (HRAS)    05214 Glioma     105003692 (HRAS)    05216 Thyroid cancer     105003692 (HRAS)    05221 Acute myeloid leukemia     105003692 (HRAS)    05220 Chronic myeloid leukemia     105003692 (HRAS)    05218 Melanoma     105003692 (HRAS)    05211 Renal cell carcinoma     105003692 (HRAS)    05219 Bladder cancer     105003692 (HRAS)    05215 Prostate cancer     105003692 (HRAS)    05213 Endometrial cancer     105003692 (HRAS)    05224 Breast cancer     105003692 (HRAS)    05223 Non-small cell lung cancer     105003692 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105003692 (HRAS)    05170 Human immunodeficiency virus 1 infection     105003692 (HRAS)    05161 Hepatitis B     105003692 (HRAS)    05160 Hepatitis C     105003692 (HRAS)    05163 Human cytomegalovirus infection     105003692 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     105003692 (HRAS)    05165 Human papillomavirus infection     105003692 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105003692 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105003692 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     105003692 (HRAS)   09165 Substance dependence    05034 Alcoholism     105003692 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105003692 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105003692 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105003692 (HRAS)    01522 Endocrine resistance     105003692 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     105003692 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     105003692 (HRAS)    04031 GTP-binding proteins [BR:bbis04031]     105003692 (HRAS) Membrane trafficking [BR:bbis04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105003692 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     105003692 (HRAS) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105003692 (HRAS)   Exosomal proteins of colorectal cancer cells    105003692 (HRAS) GTP-binding proteins [BR:bbis04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105003692 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N CdhD AAA_14 nSTAND3 Motif Other DBs NCBI-GeneID:  105003692 NCBI-ProteinID:  XP_010859349 Ensembl:  ENSBBBG00000021716 UniProt:  A0A6P3J453 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINHVKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTLWDPPGPP NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgccggtggcgtggggaagagcgccctgact atccagctcattcagaatcacttcgtggacgagtacgaccccaccatcgaggactcctac cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacagcgggc caggaggagtacagcgccatgcgagaccagtacatgcgcaccggggagggctttctctgc gtgtttgctatcaaccacgtcaagtccttcgaggacatccaccagtaccgggagcagatc aagcgggtgaaggactcggatgacgtgcccatggtgttggttgggaacaagtgcgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccg tacatcgagacctccgccaagacccgccagggcagccgctctggctctggctccagctcc gggaccctctgggaccctccgggacccccgtga

DBGET integrated database retrieval system