Bison bison bison (American bison): 105003906 Help Entry 105003906         CDS       T08726                                  Symbol CRK Name (RefSeq) adapter molecule crk   KO K04438   C-crk adapter molecule crk Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04012   ErbB signaling pathway bbis04015   Rap1 signaling pathway bbis04062   Chemokine signaling pathway bbis04148   Efferocytosis bbis04510   Focal adhesion bbis04666   Fc gamma R-mediated phagocytosis bbis04722   Neurotrophin signaling pathway bbis04810   Regulation of actin cytoskeleton bbis04910   Insulin signaling pathway bbis04935   Growth hormone synthesis, secretion and action bbis05100   Bacterial invasion of epithelial cells bbis05135   Yersinia infection bbis05163   Human cytomegalovirus infection bbis05170   Human immunodeficiency virus 1 infection bbis05200   Pathways in cancer bbis05206   MicroRNAs in cancer bbis05211   Renal cell carcinoma bbis05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105003906 (CRK)    04012 ErbB signaling pathway     105003906 (CRK)    04015 Rap1 signaling pathway     105003906 (CRK)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     105003906 (CRK)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105003906 (CRK)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105003906 (CRK)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     105003906 (CRK)    04062 Chemokine signaling pathway     105003906 (CRK)   09152 Endocrine system    04910 Insulin signaling pathway     105003906 (CRK)    04935 Growth hormone synthesis, secretion and action     105003906 (CRK)   09156 Nervous system    04722 Neurotrophin signaling pathway     105003906 (CRK)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105003906 (CRK)    05206 MicroRNAs in cancer     105003906 (CRK)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     105003906 (CRK)    05211 Renal cell carcinoma     105003906 (CRK)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105003906 (CRK)    05163 Human cytomegalovirus infection     105003906 (CRK)   09171 Infectious disease: bacterial    05135 Yersinia infection     105003906 (CRK)    05100 Bacterial invasion of epithelial cells     105003906 (CRK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SH3_2 SH3_1 SH3_9 SH3_10 DUF3804 Motif Other DBs NCBI-GeneID:  105003906 NCBI-ProteinID:  XP_010859649 UniProt:  A0A6P3J522 LinkDB All DBs Position Unknown AA seq 250 aa AA seqDB search MCGEMLKICISSPVYLSIIPCSVFFLGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTL IEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAED SEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQ NGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLL DQQNPDEDFS NT seq 753 nt NT seq  +upstreamnt  +downstreamnt atgtgcggggagatgcttaaaatctgcatttcatctccagtatatctttcaataataccc tgctctgttttttttttaggggtgagtccctccagactccgaataggagatcaagaattt gattcattgcctgctttactggaattctacaaaatacactatttggacactacaacgttg atagaaccagtttccagatccaggcagggtagtggagtgattctcaggcaggaagaggca gagtatgtacgagccctctttgactttaatgggaatgatgaagaagatcttccctttaag aaaggagacatcctgagaatccgggataagcctgaagagcagtggtggaatgcggaggac agcgaaggcaagagagggatgattccagtcccttacgtggagaagtatagacctgcctcc gcctcagtatcggctctgattggaggtaaccaggagggttcccacccacagccactgggt gggccggagcctgggccctatgcccaacccagcgtcaacactccgctccctaacctccag aatgggcccatttatgccagggtaatccagaagcgagtccctaatgcctacgacaagaca gccttggctttggaggtcggtgagctggtaaaggttacgaagattaatgtgagtggtcag tgggaaggggagtgtaatggcaaacgaggtcacttcccattcacacatgtccgtctgctg gatcaacagaatcccgatgaggacttcagctga

DBGET integrated database retrieval system