Bison bison bison (American bison): 105004018 Help Entry 105004018         CDS       T08726                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04061   Viral protein interaction with cytokine and cytokine receptor bbis04062   Chemokine signaling pathway bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04668   TNF signaling pathway bbis05020   Prion disease bbis05142   Chagas disease bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05168   Herpes simplex virus 1 infection bbis05323   Rheumatoid arthritis bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     105004018 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105004018 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     105004018 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105004018 (CCL5)    04621 NOD-like receptor signaling pathway     105004018 (CCL5)    04623 Cytosolic DNA-sensing pathway     105004018 (CCL5)    04062 Chemokine signaling pathway     105004018 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     105004018 (CCL5)    05168 Herpes simplex virus 1 infection     105004018 (CCL5)    05163 Human cytomegalovirus infection     105004018 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     105004018 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     105004018 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     105004018 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105004018 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105004018 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:bbis00536]     105004018 (CCL5) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Chemokines    105004018 (CCL5) Glycosaminoglycan binding proteins [BR:bbis00536]  Heparan sulfate / Heparin   Chemokines    105004018 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF4148 Motif Other DBs NCBI-GeneID:  105004018 NCBI-ProteinID:  XP_010859815 Ensembl:  ENSBBBG00000001120 UniProt:  A0A6P3J8S7 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYLTRPLPRTHVQEYFYPSSKCSMA AVVFITRKNRQVCANPEKKWVREYINALELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgccgctgccctcgctgtcctcctgacggcggccgccctctgcgctcct gcttctgcctccccatatgcctcggacaccacgccctgctgctttgcctacctcacccgc ccgctgccccgcacccacgtccaggagtacttctaccccagcagcaagtgctccatggca gcagttgtctttatcaccaggaagaaccgccaggtgtgcgccaacccagagaagaagtgg gtgcgagagtacatcaacgctttggagttgagctag

DBGET integrated database retrieval system