Bison bison bison (American bison): 105004029 Help Entry 105004029         CDS       T08726                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04061   Viral protein interaction with cytokine and cytokine receptor bbis04062   Chemokine signaling pathway bbis04064   NF-kappa B signaling pathway bbis04620   Toll-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105004029   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105004029    04061 Viral protein interaction with cytokine and cytokine receptor     105004029  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105004029    04623 Cytosolic DNA-sensing pathway     105004029    04062 Chemokine signaling pathway     105004029  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105004029  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105004029 Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Chemokines    105004029 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105004029 NCBI-ProteinID:  XP_010859823 Ensembl:  ENSBBBG00000003679 UniProt:  A0A6P3IZV3 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MKLCVTVLSLLMLMAAFCSPALSAPMGSDPPTACCFSYTLRKIPRNFVNDYFETSSLCSQ PAVVFQTKKGRQVCANPSEPWVQEYVDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgtgactgtcctgtccctcctcatgctcatggctgccttctgttctccg gcgctctcagcaccaatgggctcagaccctcccacggcctgctgcttctcttacactctg cggaagattcctcgcaactttgtgaatgactactttgagaccagcagcctctgctcccag ccagctgtggtattccagaccaaaaagggcaggcaggtctgcgccaaccccagtgagccc tgggtccaggagtacgtggatgaccttgaattgaactga

DBGET integrated database retrieval system