Bison bison bison (American bison): 105004031 Help Entry 105004031         CDS       T08726                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04061   Viral protein interaction with cytokine and cytokine receptor bbis04062   Chemokine signaling pathway bbis04620   Toll-like receptor signaling pathway bbis05142   Chagas disease bbis05163   Human cytomegalovirus infection bbis05323   Rheumatoid arthritis bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105004031    04061 Viral protein interaction with cytokine and cytokine receptor     105004031  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105004031    04062 Chemokine signaling pathway     105004031  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105004031   09174 Infectious disease: parasitic    05142 Chagas disease     105004031   09163 Immune disease    05323 Rheumatoid arthritis     105004031   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105004031  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105004031    00536 Glycosaminoglycan binding proteins [BR:bbis00536]     105004031 Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Chemokines    105004031 Glycosaminoglycan binding proteins [BR:bbis00536]  Heparan sulfate / Heparin   Chemokines    105004031 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 WAP Motif Other DBs NCBI-GeneID:  105004031 NCBI-ProteinID:  XP_010859825 UniProt:  A0A6P3J8T5 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MKLGGLFLLASLLTLNTRLQAIGTCVNECREDRDCGAERECLQVGCQHVCLPLATAVSTN NPTDCCFSFVSRQIPRKFVDDYYETSSQCSKPGIIFKTKRGRQVCADPSEDWVQEYISDL ELNP NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgaagttgggtggtctcttcctcctggccagtctcctcaccctcaacacaaggctccag gcaattggcacctgtgtgaatgagtgcagagaagacagggactgcggggcagaaagagaa tgcctccaagtgggctgccagcacgtctgcctgcctctagctacagcagttagtaccaac aacccgacggactgctgcttctccttcgtctcccggcagatcccacgcaaattcgtggac gactattatgagaccagcagccagtgctccaagcccggcatcatcttcaagaccaaaaga ggccggcaggtctgtgccgaccccagtgaggactgggtccaggaatacatcagcgacctg gagctgaatccctga

DBGET integrated database retrieval system