Bison bison bison (American bison): 105004326 Help Entry 105004326         CDS       T08726                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism bbis  Bison bison bison (American bison) Pathway bbis04978   Mineral absorption Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105004326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bbis03019]     105004326    03029 Mitochondrial biogenesis [BR:bbis03029]     105004326 Messenger RNA biogenesis [BR:bbis03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105004326 Mitochondrial biogenesis [BR:bbis03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105004326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105004326 NCBI-ProteinID:  XP_010860222 Ensembl:  ENSBBBG00000009320 UniProt:  A0A6P3J8E5 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCTAGESCTCAGSCKCKDCKCASCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcaccgcgggtgaatcctgcacatgtgccggctcctgcaaa tgcaaagattgcaagtgcgcctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcgtctgcaaaggggcttcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system