Bison bison bison (American bison): 105004432 Help Entry 105004432         CDS       T08726                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism bbis  Bison bison bison (American bison) Pathway bbis04080   Neuroactive ligand-receptor interaction bbis04081   Hormone signaling Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105004432 (PRLH)    04081 Hormone signaling     105004432 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105004432 (PRLH) Cytokines and neuropeptides [BR:bbis04052]  Neuropeptides   GPCR binding    105004432 (PRLH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prolactin_RP LEAP-2 Motif Other DBs NCBI-GeneID:  105004432 NCBI-ProteinID:  XP_010860352 UniProt:  A0A6P3J8Q4 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKAVGAWLLCLLLLGLALQGAASRAHQHSMEIRTPDINPAWYAGRGIRPVGRFGRRRAAP GDRPRPGPRRVPACFRLEGGAEPSRALPGRLMAQLVQE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggcggtgggggcctggctcctctgcctgctgctgctgggcctggccctgcagggg gctgccagcagagcccaccagcactccatggagatccgcacccccgacatcaaccctgcc tggtacgcgggccgtgggatccggcccgtgggccgcttcggccggcgaagagctgccccg ggggacagacccaggcctggcccccggcgcgtgccggcctgcttccgcctggaaggcggc gctgagccctcccgagccctcccggggcggctgatggcccagctggtccaggaataa

DBGET integrated database retrieval system