Bison bison bison (American bison): 105004469 Help Entry 105004469         CDS       T08726                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism bbis  Bison bison bison (American bison) Pathway bbis04068   FoxO signaling pathway bbis04136   Autophagy - other bbis04140   Autophagy - animal bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105004469 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105004469 (ATG12)    04136 Autophagy - other     105004469 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105004469 (ATG12)    04622 RIG-I-like receptor signaling pathway     105004469 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     105004469 (ATG12)    04121 Ubiquitin system [BR:bbis04121]     105004469 (ATG12)    03029 Mitochondrial biogenesis [BR:bbis03029]     105004469 (ATG12) Membrane trafficking [BR:bbis04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     105004469 (ATG12) Ubiquitin system [BR:bbis04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105004469 (ATG12) Mitochondrial biogenesis [BR:bbis03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     105004469 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  105004469 NCBI-ProteinID:  XP_010860387 Ensembl:  ENSBBBG00000020907 UniProt:  A0A6P3J8T0 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAEEQESALQLPPSTAPEAEVPTEVSPETATPEPPSSAAVSPGTEEPVGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagcaggagtctgcgctgcagctccctccctcaactgctcccgaagctgaa gtgcctaccgaggtctccccagaaacagccactccggagcccccttcttctgctgcagtt tctccgggaacagaggaacctgtcggtgacaccaagaaaaaaattgacattctgctaaag gctgtaggagacactcctataatgaaaacaaagaaatgggctgtagagcgaacccgaacc atccaaggactcattgacttcatcaaaaagttccttaaacttgtggcttcagaacagttg tttatttacgtgaatcagtcctttgccccctccccagaccaggaagttgggaccctctat gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaagcatgggga tga

DBGET integrated database retrieval system