Bison bison bison (American bison): 105005138 Help Entry 105005138         CDS       T08726                                  Name (RefSeq) glutathione S-transferase A2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism bbis  Bison bison bison (American bison) Pathway bbis00480   Glutathione metabolism bbis00980   Metabolism of xenobiotics by cytochrome P450 bbis00982   Drug metabolism - cytochrome P450 bbis00983   Drug metabolism - other enzymes bbis01100   Metabolic pathways bbis01524   Platinum drug resistance bbis05200   Pathways in cancer bbis05204   Chemical carcinogenesis - DNA adducts bbis05207   Chemical carcinogenesis - receptor activation bbis05208   Chemical carcinogenesis - reactive oxygen species bbis05225   Hepatocellular carcinoma bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     105005138   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     105005138    00982 Drug metabolism - cytochrome P450     105005138    00983 Drug metabolism - other enzymes     105005138  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105005138    05204 Chemical carcinogenesis - DNA adducts     105005138    05207 Chemical carcinogenesis - receptor activation     105005138    05208 Chemical carcinogenesis - reactive oxygen species     105005138   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105005138   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105005138   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105005138  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bbis02000]     105005138 Enzymes [BR:bbis01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      105005138 Transporters [BR:bbis02000]  Other transporters   Pores ion channels [TC:1]    105005138 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  105005138 NCBI-ProteinID:  XP_010861312 Ensembl:  ENSBBBG00000020535 UniProt:  A0A6P3JB59 LinkDB All DBs Position Unknown AA seq 223 aa AA seqDB search MAGKPKLHYFNGRGRMECIRWLLAAAGVEFEEKFIEQPEDLDKLRNDGSLMFQQVPMVEI DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVEDLGEMIMHLPLCPPDQKDAK TAQIKERTTNRYLPAFEKVLKNHGQDYLVGNKLSKADIHLVELVYYVEELDPSLLANFPL LKGLKARVSSLPAVKKFLQPGSQRKPPMDEKNLEEAKRIFRIK NT seq 672 nt NT seq  +upstreamnt  +downstreamnt atggcggggaaacccaagttacactacttcaatggacgtggcagaatggagtgcattcgg tggctcctggctgcagccggagtggagtttgaagagaaatttatagaacaaccagaagac ctggataagctaagaaacgatgggagtttgatgttccagcaagtgccaatggttgaaatt gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac ctctacgggaaagacatgaaggagagagccctgattgatatgtactcagagggcgtggaa gacttgggggaaatgatcatgcatttaccactgtgcccacctgatcaaaaagatgctaaa acagctcagatcaaagagagaacaacaaaccgttatctccctgcatttgaaaaagtgctg aagaatcacggacaagattatcttgtgggcaacaagctgagcaaggctgacatccacctg gttgaacttgtctactatgtggaagagctggaccctagccttttggccaacttccctctg ctgaagggcctgaaagccagagtcagcagtctcccggctgtgaagaagtttctgcagcct ggcagccagaggaagcctcccatggatgagaagaatttggaagaagcaaagaggattttc aggattaaataa

DBGET integrated database retrieval system