Bison bison bison (American bison): 105005149 Help Entry 105005149         CDS       T08726                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105005149  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105005149   09163 Immune disease    05322 Systemic lupus erythematosus     105005149   09165 Substance dependence    05034 Alcoholism     105005149  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     105005149 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105005149 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP TFIID_20kDa Motif Other DBs NCBI-GeneID:  105005149 NCBI-ProteinID:  XP_010861326 Ensembl:  ENSBBBG00000000695 UniProt:  A0A6P3J414 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARHGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaaggcggcaaaggtctggggaaaggcggcgctaagcgccaccgt aaggttctgcgcgacaacatccagggcatcactaaacctgctatccgccgcctggctcgt catggtggtgtgaagcgcatctctgggctcatctacgaagagacccgcggggtcctgaaa gtgtttctggagaacgtgatccgggacgcggtcacctacaccgagcatgccaagcggaag acggtcaccgctatggacgtggtctacgctctcaagcgccagggccgtactctctacggc tttggcggttaa

DBGET integrated database retrieval system