Bison bison bison (American bison): 105005290 Help Entry 105005290         CDS       T08726                                  Name (RefSeq) protein ATP1B4-like isoform X1   KO K01540   sodium/potassium-transporting ATPase subunit beta Organism bbis  Bison bison bison (American bison) Pathway bbis04022   cGMP-PKG signaling pathway bbis04024   cAMP signaling pathway bbis04260   Cardiac muscle contraction bbis04261   Adrenergic signaling in cardiomyocytes bbis04820   Cytoskeleton in muscle cells bbis04911   Insulin secretion bbis04918   Thyroid hormone synthesis bbis04919   Thyroid hormone signaling pathway bbis04925   Aldosterone synthesis and secretion bbis04960   Aldosterone-regulated sodium reabsorption bbis04961   Endocrine and other factor-regulated calcium reabsorption bbis04964   Proximal tubule bicarbonate reclamation bbis04970   Salivary secretion bbis04971   Gastric acid secretion bbis04972   Pancreatic secretion bbis04973   Carbohydrate digestion and absorption bbis04974   Protein digestion and absorption bbis04976   Bile secretion bbis04978   Mineral absorption Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     105005290    04022 cGMP-PKG signaling pathway     105005290  09140 Cellular Processes   09142 Cell motility    04820 Cytoskeleton in muscle cells     105005290  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     105005290    04918 Thyroid hormone synthesis     105005290    04919 Thyroid hormone signaling pathway     105005290    04925 Aldosterone synthesis and secretion     105005290   09153 Circulatory system    04260 Cardiac muscle contraction     105005290    04261 Adrenergic signaling in cardiomyocytes     105005290   09154 Digestive system    04970 Salivary secretion     105005290    04971 Gastric acid secretion     105005290    04972 Pancreatic secretion     105005290    04976 Bile secretion     105005290    04973 Carbohydrate digestion and absorption     105005290    04974 Protein digestion and absorption     105005290    04978 Mineral absorption     105005290   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     105005290    04961 Endocrine and other factor-regulated calcium reabsorption     105005290    04964 Proximal tubule bicarbonate reclamation     105005290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:bbis04090]     105005290 CD molecules [BR:bbis04090]  Proteins   105005290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Na_K-ATPase PRP21_like_P DUF3984 Glyco_hydro_2 Paf1 Nop14 TFB6 DARPP-32 Motif Other DBs NCBI-GeneID:  105005290 NCBI-ProteinID:  XP_010861545 UniProt:  A0A6P3JDU5 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MRRQLRSRRAPALPYGYRYRLDDQDEVNQNYLADEEEEAEEEARVMVPDLEEEEEEEEEK EEEEKEEEDSHSQEIDSAWWRKLQIVNEYLWDPEKRTSLARTGQSWSLILVIYFFFYASL AAVITLCMYTLFLTISPYMPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLN GFLQGKCL NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgagaaggcagctccggtccagaagggctccggccttgccttacggttatcgctacaga cttgatgatcaggatgaagtgaaccagaactacttagcggatgaagaggaagaagcagaa gaggaggctagggtgatggtacctgatttggaggaggaggaggaagaagaggaggagaaa gaagaggaggagaaggaggaggaagatagtcacagtcaggaaatagacagtgcctggtgg cggaaactgcagattgtgaatgaatacctgtgggatccggagaaaaggacatctctggcc cgaacaggtcagagttggagcctgatcttagtcatttacttcttcttctatgcctccctg gctgctgtgatcaccctttgcatgtacacgctatttctgaccatcagtccttacatgcca accttcactgagagggtgaagcctcctggagttatgatcagacccttcgcccatagcctt aacttcaacttcaacgtttctgaacctgacacttggcagcattatgtgattagtctaaat ggctttctccagggtaagtgcctctga

DBGET integrated database retrieval system