Babesia bovis: BBOV_III004290 Help Entry BBOV_III004290    CDS       T01085                                  Name (RefSeq) RNA_pol_N superfamily protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism bbo  Babesia bovis Pathway bbo03020   RNA polymerase bbo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bbo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     BBOV_III004290   09124 Replication and repair    03420 Nucleotide excision repair     BBOV_III004290  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bbo03021]     BBOV_III004290    03400 DNA repair and recombination proteins [BR:bbo03400]     BBOV_III004290 Transcription machinery [BR:bbo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      BBOV_III004290   RNA polymerase III system    RNA polymerase III      BBOV_III004290   RNA polymerase I system    RNA polymerase I      BBOV_III004290 DNA repair and recombination proteins [BR:bbo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       BBOV_III004290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  5479809 NCBI-ProteinID:  XP_001611560 UniProt:  A7AN58 LinkDB All DBs Position 3:complement(930256..930593) Genome browser AA seq 73 aa AA seqDB search MIIPIRCFTCGKVIGHLWEQWLELLKQNVNEGDALDRLDLTRYCCRRMILTHVDLIEKLL VYNIYDKRNQEHI NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcataccaatacgatgtttcacctgtggcaaggttataggacacctgtgggagcaa tggctggaactgctgaaacaaaatgtcaatgaaggagatgccctcgatcgccttgatctc accaggtactgctgtcgtcgtatgatactcactcacgtggacctaatagaaaagcttttg gtctacaacatctacgacaaacgcaaccaagagcacatataa

DBGET integrated database retrieval system