Bordetella bronchiseptica RB50: BB4496 Help Entry BB4496            CDS       T00141                                  Name (GenBank) putative exported protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bbr  Bordetella bronchiseptica RB50 Pathway bbr00190   Oxidative phosphorylation bbr01100   Metabolic pathways bbr02020   Two-component system Module bbr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bbr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BB4496  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BB4496 Enzymes [BR:bbr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BB4496 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CAE34859 UniProt:  A0A0H3LQY9 LinkDB All DBs Position complement(4796131..4796256) Genome browser AA seq 41 aa AA seqDB search MWFFSWILGLSLACAFGILNAMWFELREGHAHDPYKKPADE NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtttttctcgtggattcttggcctgagcctggcgtgtgcgttcggcatcctgaat gcgatgtggttcgagttgcgcgaaggccatgcgcacgatccctacaagaagccggctgac gagtga

DBGET integrated database retrieval system