KEGG   Bradyrhizobium brasilense CB627: QA636_35900
Entry
QA636_35900       CDS       T09107                                 
Symbol
sctN
Name
(GenBank) type III secretion system ATPase SctN
  KO
K03224  ATP synthase in type III secretion protein N [EC:7.4.2.8]
Organism
bbra  Bradyrhizobium brasilense CB627
Pathway
bbra03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbra00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    QA636_35900 (sctN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbra02044]
    QA636_35900 (sctN)
Enzymes [BR:bbra01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     QA636_35900 (sctN)
Secretion system [BR:bbra02044]
 Type III secretion system
  Type III secretion core apparatus
   QA636_35900 (sctN)
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C NB-ARC ABC_tran ATPase_2 ATP-synt_ab_N AAA_22 AAA_16 DAP3 NACHT MeaB NPHP3_N ATPase AAA AAA_25 RNA_helicase AAA_24 RsgA_GTPase MMR_HSR1 PRK DUF87
Other DBs
NCBI-ProteinID: WFU62771
UniProt: A0ABY8JDS7
LinkDB
Position
complement(7731484..7732839)
AA seq 451 aa
MTTQRPSHDATAEEGAVHAALSSLRSSATHIDTRAVRGRITRAIGTLLHAVLPEARVGEL
CLLRDPRSGWSLEAEVIGLLPDGVLLTPIGDMVGLSNRAEVVTTGRMQEVPVGPDLLGRV
IDSFGRPLDGKGPIKAGEARPLRGKAPNPMKRRDIEQPFPLGVRVLDGLLTCGEGQRIGI
YGDAGCGKSTLMSQIVKGAAADVTIVALIGERGREVREFIERHLGEALRRSVVVVETSDR
SAMERAQCAHMATALAEYFRDQGLRVVLMMDSLTRFSRAMREIGLAAGEPPTRRGFPPSV
FALLPGLLERAGMGEHGSITAFYTVLVEGDGTGDPIAEESRGILDGHIILSRALASREHF
PAIDVLSSRSRVMDAIVSVPHRKGASVFRDLLSRYAEAEFLIKVGEYKQGSDPLTDRAIA
SIEELRAFLRQGQDEACNFEETVAWMSRLTA
NT seq 1356 nt   +upstreamnt  +downstreamnt
gtgaccacgcaacgaccgagccacgatgccacggctgaagagggggctgtccacgccgca
ctctcatccttaagatcttccgccacgcatatcgatacgcgtgccgtccgggggcggatc
acgcgggcgattggcacgctgctccatgccgtcttgccggaggcccgggtcggggaacta
tgcctcttgcgggatccccgcagcggatggtcgctcgaggcggaggtgatcggtctattg
ccggacggggtgttactcacgccgatcggcgacatggtcgggttgtccaaccgggcggaa
gtcgtcacgaccgggcgaatgcaggaagtgccagtcggccccgacttgctcggccgcgtg
atcgacagtttcggccgcccgctcgatggtaagggcccaatcaaggctggcgaggctcgc
ccgctgcgcggcaaggcccccaatcccatgaaacggcgcgatatcgaacagccttttccg
ctcggcgttcgtgtcttggatgggcttctgacatgtggagaaggccagcggatcggaatc
tacggcgacgccggttgcggcaagtcgacgctgatgtcgcaaatcgtcaaaggcgcagcc
gccgacgtcacgattgtcgcgctgatcggcgaacgcggccgagaggtgcgtgaattcatc
gagcgtcatcttggcgaggcgctccgccgttcggtcgtcgtcgttgagacatccgaccgt
tcggcgatggagcgggcacaatgcgcccatatggcgacggcgcttgccgagtattttcgt
gatcagggacttcgcgtcgtcctgatgatggactctttgacgcgctttagccgcgcgatg
cgcgaaatcggccttgccgcaggagaacctccgacccggcgcggatttccgccctccgtc
tttgcgctgctgccgggcctgttggagcgcgccggcatgggcgagcatggctccatcacg
gccttctataccgtacttgtcgaaggtgatggtacgggcgatccaatcgcagaagaatca
cgcggcattcttgacggccacatcattctctcgcgcgcgctggcctcgcgagagcatttt
ccggcgatcgacgtgttgtcgagccgaagccgcgtcatggatgcgatcgtgtctgtgccg
catcgaaagggggcgtccgtctttcgtgatctgctctcgcgctacgcggaggcggagttc
ttaatcaaggtcggcgaatacaagcaaggctccgatccgctgaccgaccgggcgatcgcc
tcgatcgaggagttgcgggcgttcctgcggcagggccaggacgaggcatgcaactttgag
gagacagtcgcatggatgtcgcgactgaccgcctga

DBGET integrated database retrieval system